PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11012_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 407aa    MW: 45725.2 Da    PI: 7.9578
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11012_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-31251305155
                               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                           k+r+rWt+eLH+rFve+v++LGG++kAtPk++l+lm+ +gLt+ hvkSHLQkYR 
  cra_locus_11012_iso_4_len_1674_ver_3 251 KTRIRWTQELHDRFVECVNRLGGADKATPKAVLKLMDWEGLTIFHVKSHLQKYRN 305
                                           68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.506248308IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-28249306IPR009057Homeodomain-like
SuperFamilySSF466895.02E-17249305IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23251306IPR006447Myb domain, plants
PfamPF002492.0E-8255304IPR001005SANT/Myb domain
PfamPF143794.9E-19334381IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MDIQKISQQQ RMVQNYGFAG DYTLEFSNRF PQCFGSQQQF PDSGLCFQSP IRDDDGSQKQ  60
NIWPDNSSST MISHIGPPST AFFATERYMG LAQYDSRDNK DSSCCSQLSK NYDIQQQVPS  120
PYEQTGNVFF ADSCAPVEAT FHSKNGLQLV KEGSKSLGSP HLNSDGPYRN PFSNLSEKER  180
ILHLKNKLLG DCDIVNIRRP SVSFDGNQDG VVSCNWYGSH FAQLKQSGRP SACLSLASNN  240
SASSGGILSN KTRIRWTQEL HDRFVECVNR LGGADKATPK AVLKLMDWEG LTIFHVKSHL  300
QKYRNAKYMP DSAEGKSDKR PGTSAAPIDI KTGMQLKEAL QLQLDVQRRL HEQLEIQRKL  360
QLSIEEQGRQ LKMMIDQQQK TTRSLLETQT SPNPTYLSTT PETMNDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-23251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-23251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-23251308158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-23251308158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-23251308158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-23251308158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-23251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-23251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-23251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-23251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-23251308259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-23251308259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027073078.11e-164myb family transcription factor PHL5-like
TrEMBLA0A068UPE81e-159A0A068UPE8_COFCA; Uncharacterized protein
STRINGXP_009603787.11e-130(Nicotiana tomentosiformis)