PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11012_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 432aa    MW: 48615.1 Da    PI: 7.0645
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11012_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like37.17e-12251285135
                               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilel 35 
                                           k+r+rWt+eLH+rFve+v++LGG++  +    + l
  cra_locus_11012_iso_3_len_1748_ver_3 251 KTRIRWTQELHDRFVECVNRLGGADSXVMDIFMSL 285
                                           68**********************98876554444 PP

2G2-like47.34.6e-153013302655
                               G2-like  26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                           +AtPk++l+lm+ +gLt+ hvkSHLQkYR 
  cra_locus_11012_iso_3_len_1748_ver_3 301 EATPKAVLKLMDWEGLTIFHVKSHLQKYRN 330
                                           7****************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-25249331IPR009057Homeodomain-like
SuperFamilySSF466891.22E-12249276IPR009057Homeodomain-like
PfamPF002495.2E-6255329IPR001005SANT/Myb domain
TIGRFAMsTIGR015577.4E-10301331IPR006447Myb domain, plants
SuperFamilySSF466891.22E-12303330IPR009057Homeodomain-like
PfamPF143795.3E-19359406IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MDIQKISQQQ RMVQNYGFAG DYTLEFSNRF PQCFGSQQQF PDSGLCFQSP IRDDDGSQKQ  60
NIWPDNSSST MISHIGPPST AFFATERYMG LAQYDSRDNK DSSCCSQLSK NYDIQQQVPS  120
PYEQTGNVFF ADSCAPVEAT FHSKNGLQLV KEGSKSLGSP HLNSDGPYRN PFSNLSEKER  180
ILHLKNKLLG DCDIVNIRRP SVSFDGNQDG VVSCNWYGSH FAQLKQSGRP SACLSLASNN  240
SASSGGILSN KTRIRWTQEL HDRFVECVNR LGGADSXVMD IFMSLLHKTM TIDXFCADHL  300
EATPKAVLKL MDWEGLTIFH VKSHLQKYRN AKYMPDSAEG KSDKRPGTSA APIDIKTGMQ  360
LKEALQLQLD VQRRLHEQLE IQRKLQLSIE EQGRQLKMMI DQQQKTTRSL LETQTSPNPT  420
YLSTTPETMN DS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-18251333259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-18251333259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-18251333158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-18251333158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-18251333158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-18251333158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-18251333259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-18251333259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-18251333259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-18251333259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-18251333259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-18251333259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027073078.11e-158myb family transcription factor PHL5-like
TrEMBLA0A068UPE81e-153A0A068UPE8_COFCA; Uncharacterized protein
STRINGXP_009603787.11e-124(Nicotiana tomentosiformis)