PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11012_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 411aa    MW: 46144.5 Da    PI: 8.2041
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11012_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-31255309155
                               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                           k+r+rWt+eLH+rFve+v++LGG++kAtPk++l+lm+ +gLt+ hvkSHLQkYR 
  cra_locus_11012_iso_1_len_1685_ver_3 255 KTRIRWTQELHDRFVECVNRLGGADKATPKAVLKLMDWEGLTIFHVKSHLQKYRN 309
                                           68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.506252312IPR017930Myb domain
SuperFamilySSF466895.02E-17253309IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28253310IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23255310IPR006447Myb domain, plants
PfamPF002492.1E-8259308IPR001005SANT/Myb domain
PfamPF143794.9E-19338385IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MDIQKISQQQ RMVQNYGFAG DYTLEFSNRF PQCFGSQQQF PDSGLCFQSP IRDDDGSQKQ  60
NIWPDNSSST MISHIGPPST AFFATERYMG LAQYDSRDNK DSSCCSQLSK NYDIQQQVPS  120
PYEQTGNVFF ADSCAPVEAT FHSKNGLQLV KEGSKSLGSP HLNSDGPYRN PFSNLSEKER  180
ILHLKNKLLG DCDIVNIRRP SVSFDGNQDG VVSFTYRAIG MAXHFAQLKQ SGRPSACLSL  240
ASNNSASSGG ILSNKTRIRW TQELHDRFVE CVNRLGGADK ATPKAVLKLM DWEGLTIFHV  300
KSHLQKYRNA KYMPDSAEGK SDKRPGTSAA PIDIKTGMQL KEALQLQLDV QRRLHEQLEI  360
QRKLQLSIEE QGRQLKMMID QQQKTTRSLL ETQTSPNPTY LSTTPETMND S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-23255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-23255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-23255312158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-23255312158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-23255312158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-23255312158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-23255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-23255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-23255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-23255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-23255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-23255312259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027073078.11e-158myb family transcription factor PHL5-like
TrEMBLA0A068UPE81e-153A0A068UPE8_COFCA; Uncharacterized protein
STRINGXP_009603787.11e-126(Nicotiana tomentosiformis)