PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_10816_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 329aa    MW: 37300.6 Da    PI: 7.9422
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_10816_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-321972255
                               G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                          prlrWtp+LH++Fv+a+++LGG+ekAtPk +l++m+v gLt++hvkSHLQ+YR+
  cra_locus_10816_iso_1_len_1207_ver_3 19 PRLRWTPDLHHCFVHAIDKLGGQEKATPKLVLQMMDVRGLTISHVKSHLQMYRS 72
                                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.1411575IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.4E-311575IPR009057Homeodomain-like
SuperFamilySSF466894.3E-151775IPR009057Homeodomain-like
TIGRFAMsTIGR015579.9E-241973IPR006447Myb domain, plants
PfamPF002492.6E-82071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGSCGRSGGV RQYIRSKVPR LRWTPDLHHC FVHAIDKLGG QEKATPKLVL QMMDVRGLTI  60
SHVKSHLQMY RSMKNDMNRQ GQSVDKSSTQ QKNQSIQDHH HPPPPRQYYC GFEQEENISS  120
DSTMEKSHHH HPPRFSYGSL PTKRARMEEK RSCFSEKLEW RQRIVTKKPY SNDDDYGEKE  180
KETSSTSIIA DKGSAGMKEK KELERFISPP FPLIPQNLFQ NLNYPFTNAN ATAGGGPLEE  240
SDFFKARNEE KCESSEKINA AVWEDGVEGL SLSLSLHHQY HHPSSNASST SEISEAITSS  300
YSRPPSLVDC SGSYSHQYKD VNLDLSIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027099569.13e-90two-component response regulator ORR22-like isoform X1
RefseqXP_027099570.13e-90two-component response regulator ORR22-like isoform X1
TrEMBLA0A068UA234e-89A0A068UA23_COFCA; Uncharacterized protein
STRINGVIT_01s0137g00050.t014e-77(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238