PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_105483_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 107aa    MW: 11970.8 Da    PI: 8.0472
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_105483_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.32.4e-204891448
                                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          WT+eEd  l++avk++ g++Wk+Ia++m  gRt+ qc +rwqk+l
  cra_locus_105483_iso_1_len_319_ver_3 48 WTEEEDNMLAEAVKKYNGRNWKKIAECMT-GRTDVQCLHRWQKVL 91
                                          ****************************9.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.674095IPR017930Myb domain
SuperFamilySSF466892.28E-2143106IPR009057Homeodomain-like
SMARTSM007172.1E-154493IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2347106IPR009057Homeodomain-like
CDDcd001671.43E-144891No hitNo description
PfamPF002496.9E-184891IPR001005SANT/Myb domain
PROSITE profilePS500904.55392107IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
XDLMKEVGFV SNASPSDSSS DAINKKSPSG SGVRRNSCAT KRSSQAGWTE EEDNMLAEAV  60
KKYNGRNWKK IAECMTGRTD VQCLHRWQKV LNPELVKGPW TKEEDDX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-1948105966MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-1948105966MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606734.11e-39PREDICTED: uncharacterized protein LOC104101038
RefseqXP_009606735.11e-39PREDICTED: uncharacterized protein LOC104101038
RefseqXP_016450200.11e-39PREDICTED: uncharacterized protein LOC107775040
SwissprotQ9S7G77e-30MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A068UNB74e-42A0A068UNB7_COFCA; Uncharacterized protein
STRINGSolyc08g080580.2.13e-38(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1935033