PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_10417_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family FAR1
Protein Properties Length: 838aa    MW: 96591.5 Da    PI: 8.1519
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_10417_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR186.15.5e-27198301191
                                  FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk.............tekerrtraetrt 60 
                                           +fY+eYA+++GFs+ +++s++sk+++e+++++f Cs++g+++e +k+              e++  +ra  +t
  cra_locus_10417_iso_4_len_2511_ver_3 198 SFYQEYARSTGFSTAIQNSRRSKTSREFIDAKFACSRYGTKREYEKSvnrprsrqgnrqdPENATGRRACAKT 270
                                           5******************************************9999999999888776655666699***** PP

                                  FAR1  61 gCkaklkvkkekdgkwevtkleleHnHelap 91 
                                           +Cka+++vk++ dgkw ++++e+eHnHel p
  cra_locus_10417_iso_4_len_2511_ver_3 271 DCKASMHVKRRPDGKWIIHRFEKEHNHELLP 301
                                           ****************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.8E-25198301IPR004330FAR1 DNA binding domain
PfamPF105516.3E-26399491IPR018289MULE transposase domain
PROSITE profilePS509669.507679715IPR007527Zinc finger, SWIM-type
PfamPF044344.1E-4686712IPR007527Zinc finger, SWIM-type
SMARTSM005758.3E-8690717IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010218Biological Processresponse to far red light
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 838 aa     Download sequence    Send to blast
XLESGREGSV VVEDKGRRTR AVKRLIGCGW FWMSRNERVK ETEIFQAPNP NXQKKDNWET  60
SSPRPAPRVE FADSFAINNT TTLPARASES XQQLKGYLPG NLTLKKRYVM DIDLRLPSGE  120
QDKEDEEANG IAHMLDGDEE KPHNVDRLNG SMVDIGDKIN AENGGDIIPI TDMLDSKEDI  180
LLEPLAGMEF ESLGAAYSFY QEYARSTGFS TAIQNSRRSK TSREFIDAKF ACSRYGTKRE  240
YEKSVNRPRS RQGNRQDPEN ATGRRACAKT DCKASMHVKR RPDGKWIIHR FEKEHNHELL  300
PAQAVSEQTR RMYAAMAKQF AEYKNLVGLK SDSRSPFEKG RNPTIESGEA NLLLDFFTQM  360
QSINSNFYYA IEVGEDQRLK NFFWVDSKSR YDYINFSDVV SFDTTYIRNK YKMPLALFIG  420
VNQHYQFMLL GCALISDESS ATYSWVMRTW LRAMGSQAPK IIITDQDKVL KSVVSEIFSS  480
SLHFFFLWHI LGKVTETLSH VIKQNESFML KFEKCIYRSW TDEEFEKRWL KMVDKFELKE  540
NELIHTLYED RSRWVPTFVR DAFLAGMSTG QRSECVNSFF DKYLHKKTTI QEFVKQYDAI  600
LQDRYEEEAK ADSDTWNKQP ALKSPSPFEK HVANIYTHAV FKKFQIEVLG AVACIPKRER  660
EEETTTTFRV QDFEKNQEFA VTLNELKSEV SCICRLFEFK GFLCRHAMIV LQICGISSIP  720
SHYILKRWTK DAKGRYLMAE GSELVQSRVQ RYNDLCERAL RLAEEGSLST ESYNFALRAL  780
DDAFGNCVSA NNSNKNLAEA GPSATPGLLC MEEDEQSRSM NKTNKTNKKN NPTKKRKV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00078ChIP-seqTransfer from AT3G22170Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804948.10.0PREDICTED: protein FAR-RED ELONGATED HYPOCOTYL 3 isoform X3
RefseqXP_009804949.10.0PREDICTED: protein FAR-RED ELONGATED HYPOCOTYL 3 isoform X3
RefseqXP_016481998.10.0PREDICTED: protein FAR-RED ELONGATED HYPOCOTYL 3-like isoform X3
RefseqXP_016481999.10.0PREDICTED: protein FAR-RED ELONGATED HYPOCOTYL 3-like isoform X3
SwissprotQ9LIE50.0FHY3_ARATH; Protein FAR-RED ELONGATED HYPOCOTYL 3
TrEMBLA0A022RST60.0A0A022RST6_ERYGU; Uncharacterized protein
TrEMBLK4CEI70.0K4CEI7_SOLLC; Uncharacterized protein
STRINGSolyc07g043270.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49621103