PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_10399_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family GRF
Protein Properties Length: 535aa    MW: 58191.2 Da    PI: 6.4101
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_10399_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.89.5e-24177220144
                                   WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                           d+epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e
  cra_locus_10399_iso_2_len_1974_ver_3 177 DPEPGRCKRTDGKKWRCSRDVAPHQKYCERHMHRGRPRSRKPVE 220
                                           79***************************************997 PP

2QLQ55.51.7e-19118152236
                                   QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                                           +FTa Q+ +L++Q+++yKy++a++PvPp+Ll++i+
  cra_locus_10399_iso_2_len_1974_ver_3 118 PFTALQWKELERQAMIYKYMVASLPVPPDLLVPIS 152
                                           8********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-11117153IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.7E-14118151IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.849118153IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.225177221IPR014977WRC domain
PfamPF088797.9E-20178220IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MEERKRLMDQ SRNTTNNSSD KVMGGHDDDD NDDDDRHRPL LSTNGGDDGG GGPTLNDSGA  60
NEVGRSTSPR RTRDISRDDV SAANAHGADN YSASAVTVTN LTTFRSPGGG MAAALGFPFT  120
ALQWKELERQ AMIYKYMVAS LPVPPDLLVP ISSRNFSDPT APLGNGSLYG LRYQNRDPEP  180
GRCKRTDGKK WRCSRDVAPH QKYCERHMHR GRPRSRKPVE VHPSVDTNNN NKKTRLNNQT  240
PPPLQTNPTG QEADRGFASS FLGTAGQIKD PLIHGDARAT APSISRSLYK EPNRALGWMM  300
SGEMVATNGV EEQWLHLMDT KRGLPPTERH SSIYGGTNSS ILHHGFAEEP PNLFSYTDLP  360
REEDIHSSRN NDDCHLFLNS DLISLKQPQM EDYRISRGFI DAWSNGNLET INNEPSISSS  420
QGKLSPSSLN LSIAMAADSA DHHKDCPPVS NWLPFSSGGP LAEVLQPSYM AGGSNPASPY  480
ASNADSISPP ATSVSSPSGV LQRALFSQSD GSVCNSPNIA LSTAPPELVA FQWLS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027161232.11e-154growth-regulating factor 8-like isoform X2
TrEMBLA0A068U9X51e-126A0A068U9X5_COFCA; Uncharacterized protein
STRINGXP_009597554.11e-125(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230