PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre17.g739450.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family NF-YB
Protein Properties Length: 190aa    MW: 19561.1 Da    PI: 4.5031
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre17.g739450.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB50.93.7e-161791694
               NF-YB 16 imkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                        ++k  lP + + ++d+ e+v  c +efi +++se+++ + re r  i +d ++ al++lGf+++v ++++ l+ ++e  
  Cre17.g739450.t1.1  1 MIKDLLPPDMRCANDTVEMVIACCTEFIQLLSSESNEVATREGRSIIHPDHVMRALTELGFQEFVGEVNAALHTFKEET 79
                        58999**********************************************************************9854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.68E-231119IPR009072Histone-fold
PfamPF008081.8E-9156IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.7E-271120IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MIKDLLPPDM RCANDTVEMV IACCTEFIQL LSSESNEVAT REGRSIIHPD HVMRALTELG  60
FQEFVGEVNA ALHTFKEETK TAHSRKADLR KTGAEQAGLT EEEQIALQQQ MFAAARAQSM  120
TTSEVAASMT ASYDRMAMAA AAAAAAAGGG GGAGGAAGQA PGIAPGLAAP MPPLQGQVPL  180
PDAAPPAEQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B3e-24111624133Transcription Regulator NC2 beta chain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre17.g739450.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001691659.13e-83DR1-like protein, partial
TrEMBLA0A2K3CRM21e-133A0A2K3CRM2_CHLRE; Uncharacterized protein
STRINGEDP047671e-82(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP24221515
Representative plantOGRP34491727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.22e-30nuclear factor Y, subunit B13