PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre17.g714229.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family MYB
Protein Properties Length: 1007aa    MW: 105697 Da    PI: 4.7619
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre17.g714229.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.61.2e-07592634345
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         +W  eE  +l ++  ++  ++W+++a+++g+gRt+ qc  + +
  Cre17.g714229.t1.2 592 SWQLEESRKLMELADKYNRRQWHKVAEELGTGRTPGQCLAHCL 634
                         599***********************************98876 PP

2Myb_DNA-binding48.12.7e-15700744248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         grWT+eEd ll +av + G + Wk ++++++ gRt+ qc++r+ ++l
  Cre17.g714229.t1.2 700 GRWTAEEDALLHKAVGEVGRK-WKEVSKRVP-GRTAQQCRERFVNLL 744
                         9******************99.*********.***********9986 PP

3Myb_DNA-binding24.94.6e-08751792240
                         SSS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqc 40 
                         g++++eE + l da+ +l +      W+++a++++ gRt+ qc
  Cre17.g714229.t1.2 751 GAFSEEETKTLMDACSELQSAygriIWSRVAERLP-GRTDDQC 792
                         689****************99**************.******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.263535587IPR017877Myb-like domain
PROSITE profilePS5129410.63585641IPR017930Myb domain
SMARTSM007171.0E-4589639IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-7591632IPR009057Homeodomain-like
SuperFamilySSF466894.87E-12591687IPR009057Homeodomain-like
CDDcd001672.04E-5592636No hitNo description
PfamPF002491.7E-6592635IPR001005SANT/Myb domain
PROSITE profilePS500906.737640691IPR017877Myb-like domain
SMARTSM007170.0045644693IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-6644691IPR009057Homeodomain-like
PROSITE profilePS5129421.758694748IPR017930Myb domain
SuperFamilySSF466895.14E-18697794IPR009057Homeodomain-like
SMARTSM007179.1E-16698746IPR001005SANT/Myb domain
PfamPF002492.7E-14699744IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-19700752IPR009057Homeodomain-like
CDDcd001673.20E-12701744No hitNo description
PROSITE profilePS500907.631745800IPR017877Myb-like domain
SMARTSM007170.011749802IPR001005SANT/Myb domain
PfamPF002494.6E-6751792IPR001005SANT/Myb domain
CDDcd001672.19E-6752792No hitNo description
Gene3DG3DSA:1.10.10.605.6E-10753801IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1007 aa     Download sequence    Send to blast
MADDDDDDYF RELDAALFAS KTALQLLQGD ELNGDDTGAY DYPTGGTAGL PAGRVPANGA  60
GVQRHVGGPA FGDTGAYAGG SDVDDGGYQF DEDADVDDGS EEGLSSDELG EDEEERAAEA  120
AARGVLEAEA DIEQIAAADG EPAIGEERDQ GDDAGASGAA ARGTLGERQL QTARCAAEAP  180
AARPPQQQRQ RGRRGPGLGR VQGGGAGPSG AAPAAAGDGA VGQRTEEAAD EDGLQEELEE  240
EEGDEEEEED LEAGEEEEEE GGDSDHDIER YVLQPPGEVL QPDSRLARLY AALETNQALQ  300
RQLSSALERL DEHSNTAYTL ERRVRQEPII ARPHTMAARI RAIAHPRLSD LPDLGAVGVG  360
AAGLDAAAAA AAAAAAAAAA AGGTSRLAAA AAAAAAGAPQ PPTSRFWRVG ALLPPPTAEF  420
ERLAAAQQLP PRPYDRVRWP QRVVDALNKG LTLEVQSLLT RQLMERLQQQ NAGLQQNRGQ  480
QQQQQQQAGS GGAGAGAAAG AAEGAVEAVR GADAPAGEAG SAGAGGSGNG QINMQEEYDR  540
IKAVRPDSPE AVPLILQLDE AAWARVAAAH RVGRTGAECA AYYRHNLKPG ASWQLEESRK  600
LMELADKYNR RQWHKVAEEL GTGRTPGQCL AHCLRWSRHD RRPQRSAWSA ADSALLQALV  660
GRLGTNWVAV SDGFGGRFDR HQVRDRWHAV MTAGGPRRTG RWTAEEDALL HKAVGEVGRK  720
WKEVSKRVPG RTAQQCRERF VNLLSPDLRF GAFSEEETKT LMDACSELQS AYGRIIWSRV  780
AERLPGRTDD QCSRAYEGLV KHNQPHVGHM PGQLNHMERP QRGRGRGRGR GRGRSPASGG  840
RASARGGRAR SRSRAGDSSG TESEGGRAAA GEHAEDGEEQ EDQQQQQPLQ GQQQGRSDQQ  900
GGFDAGGEDA GAAVVGAAAG LPPAQCGRAR RQTRRSTGLP APEAAGGAGA GDDDGDSGSA  960
GAADRDGDGA GAYGGTRGGG NAGGSNRPKR RRIASRPQRQ SDLEED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-156457906145MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-156457906145MYB PROTO-ONCOGENE PROTEIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1823832RGRGRGRGRG
2823833RGRGRGRGRGR
3988992KRRRI
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre17.g714229.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP73551617
ChlorophytaeOGCP42351111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.25e-27myb domain protein 4r1