PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre17.g696750.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family G2-like
Protein Properties Length: 2831aa    MW: 277602 Da    PI: 6.0235
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre17.g696750.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like802.9e-2518251878155
             G2-like    1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55  
                          +pr+ Wt+eLH rF+++v+qL G e A+Pktil +m+v+g+t+e+v+SHLQkYRl
  Cre17.g696750.t1.1 1825 RPRMLWTHELHLRFMHVVSQL-GVETAVPKTILSMMGVDGMTRENVASHLQKYRL 1878
                          59*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.14318221881IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2518221882IPR009057Homeodomain-like
SuperFamilySSF466897.7E-1718231882IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2018261878IPR006447Myb domain, plants
PfamPF002491.0E-518271877IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2831 aa     Download sequence    Send to blast
MQPSDGIQSS RAGPAAPMQG SNPPGPAGPS LLLSTGEADA MVQLQLQQLQ QQQHQHHQQH  60
QQQQQQQQQQ ALLIAHLVQA QAQNAGDATA AARAILALLG PSLAAAAALQ LSMPPALQLQ  120
MSLQQQQQQQ QQAAALAGLG EAALWQSNAA GSLPLQLQLQ LQAASGGGLG AHANVGQVGS  180
VLQLQRPGSA VSQAGLPSVT GASGGSGNGG SMQQLPQQQP QRSCDAAAAA QNADVLRQLQ  240
LPSQQQPPPA GFQDAGREGS GQQQQQQQPQ PAQNGTGPSV ATVSAATAAA TAAVSAAWHS  300
TLDAVHQQHQ TVTGGGAVGL NSQAALWAAL APVPQQHSQT QAQNQLQQIS AALVPNHRGD  360
GSAAQAGHVL QATTNAAGHG ARPGALQAQR PASPLCRPVA RRDGALPLRY AEQQQQQQRA  420
KEQQPTQSSG ASGSGSGNGG TGCGSGVSGC GSGSAAAPRS CSAGDRDAGD GGSDGDAAGK  480
GRAQLQNQRA GASASGQRAH PERRAAGCGS GDVVAMVRPQ VINSDKREAA DGEGDSGLRC  540
QQQHLPRQPS GQGWLPQPLE AAAVTIKVED GVKASRDAGS GGALLPGAPF NPAQGLSSYS  600
SGAGGLQHLQ PSQPTRLSLA RLQHPPGHQS ASACPHSPSQ LQAGPVPAAA RKTSLSLQLQ  660
QARSLANAEV EEAKAVVAVA ALAAEAADVA TATAAADTTL VCGCACGESL LAPNAHGTSE  720
PDTAGAGDAG SGSSSRAHGA LASDTGGQGD AGGAGGSGAA AGTTQPTGPG AGPSGGSDAA  780
ADGSAAEAAV ADAMTTSPPC GAPPAGYTGG TGGTGGAAGT AGGSAAALGA SGPVGHATGG  840
ATTTGGGHKR GLADTAWGGG GSPHSSGGGG SGGVEGRAGG RKHRHLNSPV HGSGSGSGAD  900
ATASGRVRQL SHRTQSRLPD GNDTGGDDGM GGDGDAPRLT RIPNALPHSR SPSAQRMVND  960
EEEGAEEAGE GEEGGAQPQP PLPQEREHDV LPPLAGSKHH HSHHHSAHVR HSHNAHYRAH  1020
PHAHAPQSAA QQDEVQGHLR RRGQQHVQLE GGQGHQQALT AVVPKPKPKP SGHPAQADIV  1080
MDGGGGDGGD GANLPSQSRA LSQLADGAQQ QCPQRALPLA DYEEGVAEAP GGPEQLDLQD  1140
GGTAARGLGP MQLGFRGLGA QGAAAADEEG GMCGDEAMGD EDMDEEDEVD EVDQEEGEPD  1200
QAQVADTADA EGEGEAGGLA ADGGAAGRGG EGGGMTGSNA AGPVAAASKR TGGGFPAMVA  1260
AAAHRQRQRR RIAGAGAVGG AMLGQTSNAA GEEEEDAEAE GLEQEGSRSS HCGDSDMVVD  1320
EGGGSGGGGS AGGSGGDGSR GDGDGSGGDG DGSGGDGDGS GSGANGNGGG SGASRATAGV  1380
GASGAGAMAG VHLSASTTMH VATQLQMQQL GSKGGAFRAG RQQLHIGSGA AGNATLQHLQ  1440
HLAPPAGSLT GSARSGAVPA GVAAGVHGTQ PLAGCGPGGV GGGSGLAGAG GGGGGTTTAA  1500
VASNNINNHT TATSQAPRSG PHHATRRQLQ HQQQQLLQAG SAVGRGCMQQ DQQQAQGRHH  1560
SHAQDHGMQS DMDVDAKPEQ QQQQEDGQVA DAVGARAAGR GAGARKERAE EAAGGLTTPS  1620
GTGDRHAAPR GGAGGSASGG PPGASGSGSG GRSGSGGDTA FDQAGAGGSK TGAVTPNGHV  1680
KATEAGGSGS GDAGGAASAS RAPEQHQSRQ EPEPQRQSAQ AEAGALVRSG SARGLNAASG  1740
GGSGGSGGGS PEQTQTAETR RHGTNGIGGK GAGNATVTAT ATGVSTGTGS GIAGSGAAAA  1800
GTEGGGGGTG GGGSGAHGQG RSSKRPRMLW THELHLRFMH VVSQLGVETA VPKTILSMMG  1860
VDGMTRENVA SHLQKYRLYL RRLAGVAPNT PIPAHMVDGV QQQALRQHML KQQQQLHQLA  1920
TLQAHQAALG SVVGAVSGGA GGSAGGPPAQ VLLSSAASGS PAAQVALQAG LPPAAALQAL  1980
QALSRQSAHS LPGAAGLSTN AAAAAVPSVA LSLVAAGLQQ QSQQSQQQQQ PQLAQASQSQ  2040
AVAAVAALGG LGGLGRLLGA VQMNQLSQIS QLNQLQQLGQ LGQLGQQLGV GALSGLQAAP  2100
LQQQLQALQA LQMLQSGAAG NGQGLAVGGL GGLGSLSALG AGAGGGVFES ANVNVMLGGP  2160
GAGVIAATDM SSLPSTGNGN GNGNGSLQSA GPSDAVDPAA VTDAAEGAMA GAAAADGSAA  2220
GDTGGDTGAG SETAVGLHSS GVLGDAMLEA GADAPATGNA VSGDATQAPL QQQQHQANAA  2280
AAANGAAWQQ QLQQWQAQQQ LAAIVALSQQ QQQQQLLLHL HLQQQQQQQQ QQQQWQQLQQ  2340
WQAQQQLMQG LSAMQQQQPQ QLLQLQHQEA GQQQQQQQQL NQASPQLQLA SQQDAQGHMT  2400
SLLQLGGGGG SMSGGGGSQQ QQQPSLQQLL MEGGGNGQLA YGAGSAGSCG FQVVTPAGAQ  2460
AGGGGAGLGP LLGGLGGLYG GLDAAQQQAA ALQHLYAAQQ QQQQQAQAQA QQQQQQAQAQ  2520
YLLQAAAAAN AQQQAAAAAA AAQGMNSYMG GGAPGGVSLS DGSGGVFAGM GGLGHLGMAS  2580
FNASLAQKQH QQQPGEGVPP QSPIPGDLRQ QQQQPIMVHG GPGTQQALQA DQGSGPPRSN  2640
NGDGDGAMST FGGWSQPQEQ LQFLEQQQQQ QQQQQQQQQQ QQQQEQQQTC RQPGMVLGRN  2700
GGPYAGTNGT TADLAGDYLQ LSQMFGSGSG PNGGYMEPQD RLMESMMAAA AGPGPPAADA  2760
RACSGSGSGS AGGQDGRGAP EALSSGSLEY QLPQMFGGLG GGVGGGGGLA GLSLMGMNLG  2820
GSTAGSEQQW *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-2118251881157Transcription factor LUX
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre17.g696750.t1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3CNN90.0A0A2K3CNN9_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Representative plantOGRP11571753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.17e-24G2-like family protein