PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre16.g672300.t1.2
Common NameCHLREDRAFT_184386
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family YABBY
Protein Properties Length: 207aa    MW: 22663.3 Da    PI: 10.9468
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre16.g672300.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY23.51.6e-073610394163
               YABBY  94 tsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                         ++++++  + ++  ++ ++p+v +P  k  r+Psayn f k   q+++++nPd    e  s     Wa +
  Cre16.g672300.t1.2  36 AKKATKPAKAEKAPKAEKAPKVEKP--KAMRAPSAYNLFYKAIFQQVRSENPDKKVTELGSKVRDKWASI 103
                         3444444566666677777888888..7899************************999999999999976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF470951.44E-1349123IPR009071High mobility group box domain
SMARTSM003981.9E-961131IPR009071High mobility group box domain
PROSITE profilePS5011811.01762130IPR009071High mobility group box domain
PfamPF005052.1E-1364127IPR009071High mobility group box domain
CDDcd013901.03E-964121No hitNo description
Gene3DG3DSA:1.10.30.106.0E-1264121IPR009071High mobility group box domain
SuperFamilySSF470952.23E-17132199IPR009071High mobility group box domain
SMARTSM003981.5E-11135198IPR009071High mobility group box domain
PROSITE profilePS5011814.048136204IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.6E-15137202IPR009071High mobility group box domain
PfamPF005054.9E-15138195IPR009071High mobility group box domain
CDDcd000842.27E-11138199No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MLRYAALRTV PRAIAPARRA MVIRSFSESN DAAPPAKKAT KPAKAEKAPK AEKAPKVEKP  60
KAMRAPSAYN LFYKAIFQQV RSENPDKKVT ELGSKVRDKW ASISALERAP YEAQAAARKK  120
EVDAKRAEVL AAKKAAARPV TAYIAFANAK RPEIKAQNPD KTMAQVASLL GSIWKGMSEE  180
QQKPYRDQAK AAMDAWKAKQ QAQQSA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.77190.0nutrient deficiency
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre16.g672300.t1.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001695913.11e-141high mobility group protein
TrEMBLA8J3F01e-140A8J3F0_CHLRE; High mobility group protein
STRINGEDP012501e-141(Chlamydomonas reinhardtii)
Publications ? help Back to Top
  1. Merchant SS, et al.
    The Chlamydomonas genome reveals the evolution of key animal and plant functions.
    Science, 2007. 318(5848): p. 245-50
    [PMID:17932292]