PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre14.g612100.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family Nin-like
Protein Properties Length: 1717aa    MW: 172640 Da    PI: 5.8543
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre14.g612100.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK50.25.1e-1615371583349
              RWP-RK    3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRki 49  
                           +++l dl+ y++ pik+A+k Lg +l+  K+ CR++G++RWP Rk+
  Cre14.g612100.t1.1 1537 RQVTLADLKLYYESPIKSASKALGFSLSCFKKLCRRLGVPRWPARKL 1583
                          689*******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.4615281606IPR003035RWP-RK domain
PfamPF020423.6E-1515381583IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1717 aa     Download sequence    Send to blast
MPRLPEEVEV EEGAVVPEEQ LMALGSADFM LNSFPDVRMG DDGGTSVDGC SSGTTAWLAA  60
MQQQQQQQQQ QRQPAPATAP PAEDAPVESA HAASADAAAT AMASGDCQRA AASLVPPSQQ  120
PQQPQPMTLA VNSRARRPGI LSLVAGSVVG NRVSSDASAH VVSTTPTAAF TTPQGAQPQA  180
AGQALQQAAV PASDSAVSTV AVASSADGNG ALPPGVMVNI SVRSTEWLRV PDRWGLPTPA  240
EVVAAAAGAA AAGASQAGDF SAHPKIPMSW LFCGRGAHSI SDPVALPAVQ QAAVAAAAGA  300
AAAAHAAAAA VRAAAAAAAD TEAAARAEGG GACSPDADGV LAARRASSTA AFQQLQPALR  360
LPHSSIPQLP AVAEGLLLPP PPLADAPAAA PAGNGRGHGH SEHDAMLSTG PLPDDELLSA  420
WDDDWGPMVP PAGAAARLPP VDRGLLRGLS PWSAAEAELE AVAVGHLLAP LPPLACLQTH  480
MQQPQGGNGG AAAGTRRAEA AAAGARTSIN APPADGARVR SSTRSASRNA AAGAQLAAAS  540
AGAKTAAGGA AGGPHARAYS PFAAVTDSTG AADAVAASAP PVASGAASDG AALDQRTGSS  600
ALAASPATAT AAAILRTQSL NLEPLEPLPQ LPLLEEVHTA FCAGGSGGGA DGVDDMFFEA  660
AAAAAAAAAA AAITISASPF SAAAAGAGLR MDAAADSAAF ALLTASGRGV GSGFGAPGSR  720
QYASADDMVN LLACFARSDS GVDMATQLQV QQQEAPVARM QHVPLSFSNV IPDGGSAHMV  780
PSFAAGEGES MAAAMAGPRP VSPQAAGVAA VAAAAAAMLS PAPPLLTVGQ QQPGPTELIP  840
VRSAVRARGS HAGHPAGAAA VDLRQGLPDL GAGAGAGAEP PAAADVAPAT RLLSGRQHPV  900
CCWPQPLAAA VVGTGAGTAA ERPPSAGMSF GGYGIDGNDD DDSPVEGHLE ALAAAAPTGN  960
NSQRTSVTMI DAFDVLTSME RIKTLQIEPP HAAPAQHHDN EAPPHATVAA TAACCPKPAE  1020
LLHTDGQHHT GAHLQQLQLP QHARLTRLSA PDFFADAPHA AAATHFGAVS IAGAVASVTA  1080
ADACPSSNSA PLPCFALGSG MVDFLAPPTG LTGDGAAAAA GIAWALQQAA RSSYDGGSHV  1140
PYPHPYAQQQ ARMHVSGAGT ITGSAPSTCA AYGLADSLVP TATRAASATP GDITFNGGVV  1200
DDVRQLCQPL QLFAGLDPAG LIPELQYQQH LHQHQHQADG TTASAPAVIS VARKRQQHQH  1260
QQHQQQQRQQ HQHQQQHQHQ HQQQAPGLVR LLSGTMMHAG VPRQQQQQQQ GSAASAGGAA  1320
AAAAAAPPPP LAAVRVKVEV AAEEGGAPGP VRQQPLRAAQ AQAQALALVV KLEQQQAAEE  1380
HIDVLLLGVP QQERRRRLPH DDDADRDYVC SEGEGEQAAA ERGDVDDVDD EGEAGGAGRK  1440
KKQGGGGGRG SAAGLGAARA KGKAAKGRAS SATGSPAHKG KRNGGGPGKA AQARAKAQVA  1500
VEWPVGLQAE PAAAAQDYEA AGGSGGGGGG ELEARSRQVT LADLKLYYES PIKSASKALG  1560
FSLSCFKKLC RRLGVPRWPA RKLLCLKKMR DALRAAGSDC GGRGSSIDSE ISAEERERLL  1620
ERVKLNIAEI YDNPDTPMYG EFTRVRHLQY KSRTTVRRKA ESSAQAAGGG VAKRQGWREC  1680
YSLGADDSTS EGEAEVEDDV EDEEQVEESD GPMSAV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre14.g612100.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3CXA80.0A0A2K3CXA8_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP609428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.19e-09RWP-RK domain-containing protein