PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre13.g568350.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family bZIP
Protein Properties Length: 1151aa    MW: 114711 Da    PI: 10.1621
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre13.g568350.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.64.6e-0710691119353
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1    3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53  
                           +kre  +++NR+A+rr+R+R k  i  L +kv+e ea   +++ +l+ ++
  Cre13.g568350.t1.1 1069 TSKRELCRERNRSAQRRFRERQKDTIRILSDKVAEQEALIADMQRRLDAYE 1119
                          689*********************************999999999998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF819951.12E-6170221No hitNo description
CDDcd146884.15E-810701115No hitNo description
PROSITE patternPS00036010761089IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1151 aa     Download sequence    Send to blast
MTLVGRHQPE DSYVAAGAPL VFRPLFKPKR PSDGMVSNAE DDEASAGMGP VINPSTLCPP  60
GDEHTNALLL SLMHNSAAAG GGRGGGGGTA AGSMQQHAKQ QAAHQQHMNN ARRSSGSASG  120
FAGGAAGTGG EAAFSGPTAD LVTASAKVMV ANFIAQVQAE SEAAVQAHIR QQQQQQQQQQ  180
QQQQQQQQQQ QQQQQQQQQH QQHQQQQQQQ QNMMLLQAGQ QRVLGGAGNH APPAIAALGA  240
VTPVHPAAIV FGAAGVSGGG DGGGGGNLAA AAAAGCASPI FGSPSLSAPQ PAAGATTLSG  300
QPLLLSAPST EAALFARTSG MSAPSPSLAP DPLPQGLHVM HGGMLGGGGG GLSGGLGGRL  360
GSGLLLGGGL LGGAAAGGPQ LQRLQSLPLS SAGLGYGMQQ PPLGGGTAAG LQLSDVGRMQ  420
QQQAAAALKL PHQQQMPPSR PQMLRELMQL QAQQQELQHQ QELQHQPSHR HHLQQKQLQQ  480
VALGFDTGGG GVVMQQQQHS DEYQQAQRQR HLLLLLHKEQ QAQRAQQLGM PAVGGGMTAE  540
EALMMRLRSA SAAAPLATAQ QLAQQPQLLA PLPPPPPPLP SQQLQQQQQQ QQQQLFHQQA  600
PLQLLRAQSK VEDDVMEDAV AAPPPPPPPP AAAALYAAAQ QALAAGGLAR GTRDEPSSGS  660
PDHAAAAVPT DARSGGPGAG VAGASGDDSS NNGGGGNAAE RGRGPGHPPA MVAAAPTPAA  720
NTAKASATAA LHPTGDVAKP SPAGGGGGSS RPVRAAAASR RNPADSEAAA TTAATAAASK  780
DRDGGSLPPS AMPAAEPAKP STMPAAQPAK PAVQGAPPPA AGAPNGAAPA GCSSPSQRQS  840
GNGKAAASSG TAEAAAAAPS KPAAAVAKAE LKQGAAGGDA DSGSQREVAG GASRQPQAAR  900
RASRRSAAAA AQAAAATPVA AVNNGNGAGS GSAASGGGAR AAARTQAPAA TATAGTAAAV  960
ATAPIASKGQ KRGSGVAGSG AAMPSGGGTS GGAGGGSKAA KKARRKGSVD EGKESAAEDD  1020
GEEEAEEEEE GEECNDDDST SSGGEGSARK RPRKASGAGA ATRRQPSATS KRELCRERNR  1080
SAQRRFRERQ KDTIRILSDK VAEQEALIAD MQRRLDAYER AGPPPAGKRP AAAAAAGRKD  1140
QQQQQQQGKK *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18087GGRGGGGG
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre13.g568350.t1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001693706.10.0predicted protein, partial
TrEMBLA8HS360.0A8HS36_CHLRE; Predicted protein (Fragment)
STRINGEDP089600.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1239833