PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre12.g521150.t1.2
Common NameCGL19, CHLREDRAFT_205894
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family Dof
Protein Properties Length: 625aa    MW: 62187.6 Da    PI: 8.4597
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre12.g521150.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof107.37.9e-3493152261
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         ++k+ +cprC+s++tkfCyynny+++qPr++Ck+C+ryWt+GG+lrn+  G+grrk+k++
  Cre12.g521150.t1.2  93 PDKKEACPRCNSMDTKFCYYNNYNIKQPRFYCKTCQRYWTAGGTLRNIAPGSGRRKSKSK 152
                         68999****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-2189140IPR003851Zinc finger, Dof-type
PfamPF027013.9E-2995151IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.64897151IPR003851Zinc finger, Dof-type
PROSITE patternPS01361099135IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MVDGGSRAAS GQLDDWAAGV AADLDQGEGD RAGARRRPAR DASPAPDARK VTTFTNKKRP  60
ASDRDSSPEE DDEEQAQKGS LKADGTRPKL PRPDKKEACP RCNSMDTKFC YYNNYNIKQP  120
RFYCKTCQRY WTAGGTLRNI APGSGRRKSK SKAAREKNSP SLAEQLTAVA AGQGMFGLGG  180
GGGYNGISPA LALAAATDPT GLLAANSAAA YGLGGHGTIS GLKLGGVGGL PAQFNSELAL  240
REHLAGQHSL ETRLLLNGHL SAEDLPNGMS AAALAQASAQ LHALHGQGSG IAQSLAAGNG  300
HTGSPSPSPP PAGNGGQQHP LSSSPQHGGG SQASQQPSPP QQGSDDAEGG GEERYVAQGR  360
RVRVKAELDG NAVSSSLAMG GGGGSGAYAN GASIASSIAN AQLAASLSMP PSMGALAAVM  420
GPGGGPSGLH PLLAQDNGGS LLDAGLTRQQ LLVLQQHQAM QQAQQQESLQ QLSSLQQLQG  480
LAALHGQHSA AGLAGLDPLQ RSALLHSAAG LGGVGVGGWL QGGGGGNSLA AAAALESLQA  540
QHLLQAQQVH PSAAAALIGG GGSSAAAQML QAQAAAAAAG GGGGWQGVAS AANWPSAWSS  600
YSGPSSGSYA GYALQAAAAY SGAR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.32500.0normal conditions
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre12.g521150.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001696918.10.0predicted protein
TrEMBLA8J5X00.0A8J5X0_CHLRE; Predicted protein
STRINGEDP006100.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP46551111
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-24cycling DOF factor 2
Publications ? help Back to Top
  1. Merchant SS, et al.
    The Chlamydomonas genome reveals the evolution of key animal and plant functions.
    Science, 2007. 318(5848): p. 245-50
    [PMID:17932292]