PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre12.g510200.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family bZIP
Protein Properties Length: 354aa    MW: 35933.3 Da    PI: 6.8248
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre12.g510200.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.82.3e-081612111060
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                         k+kNR A+rr+R+R k  i +L+ kv+ L ++  +  ke+++l++e a l+
  Cre12.g510200.t1.2 161 KEKNRQAQRRFRERQKDLIHNLKAKVEDLANKVAENEKEISMLREENAMLR 211
                         79*************************9998877778*********99776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-4155216IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.4E-10161214No hitNo description
PROSITE patternPS000360161174IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.85E-10161213No hitNo description
PROSITE profilePS502178.829161217IPR004827Basic-leucine zipper domain
CDDcd146861.48E-11161208No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MDLGHIFVGE NGSLYALVPA EAEAPPPAPA RGASRDGNLA QALLAELLRQ QQAQEQQRRQ  60
QQLAMQLEGL ASGGGSEAGL LNLLLAQAQL QQNEDNSMSI DLAPGPASTL TMAPQLAEPP  120
PTGPLPTRPA PRRVVQATSS PSNSDTGSPP RVSGGVSVSA KEKNRQAQRR FRERQKDLIH  180
NLKAKVEDLA NKVAENEKEI SMLREENAML RGRVDAKQHV GSGLSGALPS ALQSLLQMTS  240
AAGAEGGGTG AGGSGLGGLM ALRGLGPLDA LPLGNAPNGS SGLPASADLP QAQTLDLASF  300
GLGLGGGGGS SAGGGGKRNG GGLDLGNARG NALVQANGLR NSEPIIKTEP ERL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1314321GGKRNGGG
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre12.g510200.t1.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001691050.11e-104basic-leucine zipper transcription factor
TrEMBLA8IKL81e-104A8IKL8_CHLRE; Basic-leucine zipper transcription factor
STRINGEDP054961e-104(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP793645