PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre12.g501600.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family bZIP
Protein Properties Length: 903aa    MW: 89920.3 Da    PI: 6.7069
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre12.g501600.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.95.1e-09322376559
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                         kr rr + NR +A +s +RK++++e+L +  +  e e+  L+++++++k    +l
  Cre12.g501600.t1.2 322 KRVRRIIANRMSAAKSKERKQQYTEQLSQMLDDTERERAGLQQQMDRYKVDNTRL 376
                         899********************************************99777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-8318382IPR004827Basic-leucine zipper domain
PfamPF077161.5E-7320370IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.209320383IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.7E-9320380No hitNo description
SuperFamilySSF579594.82E-8322378No hitNo description
CDDcd147032.69E-16323374No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007231Biological Processosmosensory signaling pathway
GO:0008272Biological Processsulfate transport
GO:0009294Biological ProcessDNA mediated transformation
GO:0009652Biological Processthigmotropism
GO:0009970Biological Processcellular response to sulfate starvation
GO:0045596Biological Processnegative regulation of cell differentiation
GO:0051170Biological Processnuclear import
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
GO:0051019Molecular Functionmitogen-activated protein kinase binding
Sequence ? help Back to Top
Protein Sequence    Length: 903 aa     Download sequence    Send to blast
MSEWSQRLTV PAAAHRKTRS DTFGLMAMGA LNSWQEMPGL HTDAAPTSSP SGGEQGPDSS  60
SMDTEMAFVA VEADDAEMAG ATRERRKVSR RTGRAAGASS AAAGRQGSGA TATAAISAGL  120
VAPGISQGPE VGRAASSASL GSAGAWPLPH GPAPAGLQHP ACHTRSQSES FSDKLGGLAG  180
LQVGSFSSAR DAPASGMRQH VGAGGALLPL PPKAAASAQA RATSSGGASG SGGSLYNEAG  240
VGRSGMDEEL QDVEEEQELE DEDEELQDAA EEGGRRRGVK GGRSRSRGAR ASGGGDDSKG  300
GDKRGGGNNG RTQRELMLLD PKRVRRIIAN RMSAAKSKER KQQYTEQLSQ MLDDTERERA  360
GLQQQMDRYK VDNTRLEGYV EGVRREASSL TSTLTALRQQ GDELLRQLHA ARMAAAGGQS  420
PQAAGSAPGS EAPVPVPPEV DAAMKAAAAG AAAAAPPAAN FAELLSEGLT PEDLAAVERG  480
TLAVKAEPMA SQHQQAPARV PSATGMLVPR STTGVTQPPQ LVRPQHMAPG AAAPPQQAAL  540
SAQQQPQATN STSAAPPAAA TSAGGAPLHS MAPGVAPPGG FSHRPTQSAD AAAFMTFLPH  600
LGSLGPGNGA AVPGSSTLLP PGVGRGAFYA AAAASPPGAG PGSNDSSMLG LGLGVGAGGL  660
GPAAVAAMTS GPGSNSLSLP EPLDMTRARA AAEALAAAEA HGAAGGALGG LSVMAPGVAP  720
GAAPDMHTAA AMGMGLGMGM HGLGGAGTGM DAAVMSLSRL SAPMPGAQAL PVQLAGGAMQ  780
MPMGLVGSNS FGAGGGVGVG VPGALYAPGS AMAAAGVTVS AAAAAAVQQQ ALALQQQQLQ  840
LHQQQLHLQQ QQQMLALAAA GHLSAQQQQQ QQMDTTESFT IGRQVTTSLR PCVTTDPWRG  900
PA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.92290.0normal conditions| nutrient deficiency
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00129DAPTransfer from AT1G06850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre12.g501600.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001690784.11e-120predicted protein, partial
TrEMBLA8IJA61e-120A8IJA6_CHLRE; Predicted protein (Fragment)
STRINGEDP052301e-120(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP678544
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.23e-10basic leucine-zipper 52