PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre12.g495100.t1.2
Common NameCHLREDRAFT_196473, PSR1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family G2-like
Protein Properties Length: 753aa    MW: 75798.9 Da    PI: 5.7095
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre12.g495100.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.94.8e-33187241155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k rlrWtpeLH+rFv+av++LGG++kAtPk il+lm+v+gLt++h+kSHLQkYRl
  Cre12.g495100.t1.2 187 KSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRL 241
                         68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.302184244IPR017930Myb domain
SuperFamilySSF466891.97E-18185244IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-31186243IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-25187241IPR006447Myb domain, plants
PfamPF002491.2E-9189240IPR001005SANT/Myb domain
PfamPF143794.8E-15385426IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MDKAERAAGG PNAASEDDWL LEFWPEPAAD FPAPVAPMLS QHQDAAQLPE AMPQQQGLAL  60
GGYGLTQQPS DFMQTGMPGF DAFSSGKAAT LGLPLLADPQ RASTDGASAL MNAAQQSSEY  120
MLAPGMGGMP HLLAPSVGTA LPGTGHTGFA DLSMGGMAGG IPGLGGPGIM HGQYFMQPQR  180
AATGPAKSRL RWTPELHNRF VNAVNSLGGP DKATPKGILK LMGVDGLTIY HIKSHLQKYR  240
LNIRLPGESG LAGDSADGSD GERSDGEGGV RRATSLERAD TMSGMAGGAA AALGRAGGTP  300
GGALISPGLA GGTSSTGGMA AGGGGGGGLV TEPSISRGTV LNAAGAVATA APAAAAPAGG  360
SAAVKRPAGT SLSSGSTASA TRRNLEEALL FQMELQKKLH EQLETQRQLQ LSLEAHGRYI  420
ASLMEQEGLT SRLPELSGGA PAAAPVAAGG AAGGMIAPPP PQQQLQHQPQ LLQPQGSLPA  480
GGSSEAHAAA GAGTMVVHQQ QQQHVHHHHQ QQQVQMQQHA RHCDTCGAGG AGGAPSGGSS  540
MQQLQAAEQQ RTELVVAGRL GSMPAPASSS PLAGQAHQQQ PLAGGAAHLV HVHSHTPGGQ  600
PHVQHQDAFA GAATAAAHAS PGLPQSHSHL LPADLSSNAG PDTSAGQIKP EPDMSQQQQQ  660
QEQQEAEQLA QGLLNDSSAG AGAVSGSDGG GLGDFDFGDF GDLDGGAQGG LLGPGDLIGI  720
AELEAAAAHE QQQEQEHDPL DADRAKRQRV EP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-23187240154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-23187240154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-23187240154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-23187240154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Function -- GeneRIF ? help Back to Top
  1. P starvation-induced lipid and starch accumulation is inhibited in a mutant lacking the transcription factor Pi Starvation Response1 (PSR1). Transcriptomic analysis identified specific metabolism transcripts that are induced by P starvation but misregulated in the psr1 mutant.
    [PMID: 26704642]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre12.g495100.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1744800.0AF174480.1 Chlamydomonas reinhardtii phosphate starvation regulator protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001700553.10.0phosphorus starvation response 1 protein, transcriptional regulator
TrEMBLQ9S8070.0Q9S807_CHLRE; Phosphate starvation regulator protein
STRINGEDO979970.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-25G2-like family protein
Publications ? help Back to Top
  1. Wykoff DD,Grossman AR,Weeks DP,Usuda H,Shimogawara K
    Psr1, a nuclear localized protein that regulates phosphorus metabolism in Chlamydomonas.
    Proc. Natl. Acad. Sci. U.S.A., 1999. 96(26): p. 15336-41
    [PMID:10611385]
  2. Merchant SS, et al.
    The Chlamydomonas genome reveals the evolution of key animal and plant functions.
    Science, 2007. 318(5848): p. 245-50
    [PMID:17932292]
  3. Wang J, et al.
    A phosphate starvation response regulator Ta-PHR1 is involved in phosphate signalling and increases grain yield in wheat.
    Ann. Bot., 2013. 111(6): p. 1139-53
    [PMID:23589634]
  4. Bajhaiya AK,Dean AP,Zeef LA,Webster RE,Pittman JK
    PSR1 Is a Global Transcriptional Regulator of Phosphorus Deficiency Responses and Carbon Storage Metabolism in Chlamydomonas reinhardtii.
    Plant Physiol., 2016. 170(3): p. 1216-34
    [PMID:26704642]