PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre10.g454850.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family bZIP
Protein Properties Length: 1364aa    MW: 128662 Da    PI: 8.622
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre10.g454850.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1383.5e-12460511455
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                          k+  r++kNR+AAr++R++K + + + +e+ keL + N+++k ++ ++  +
  Cre10.g454850.t1.2 460 EKAKERREKNRIAARKCRAKKVQMVRHMQEELKELVSANHEMKTQVVTWHRM 511
                         68899**************************************998888766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.2E-11457507No hitNo description
SMARTSM003380.0026457525IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.737459505IPR004827Basic-leucine zipper domain
PfamPF077161.4E-8459505IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.0E-9460510No hitNo description
CDDcd148099.10E-15462513No hitNo description
PROSITE patternPS000360465479IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1364 aa     Download sequence    Send to blast
MASLRTGSLQ QPQLKKQPQQ STEEISPAAA SQQQRGKQQL LKPQQGKGKG KGKGFANKPP  60
SQAAATAAAA AAAVGLLDPG APAAAGGELL QPPAAPAAAT ASTSQSAENS CVSLDLGTGG  120
CWAASGAAAA PAAAAAAAGR GGAGSFLAAP SAEPSAPTVP AAGAAASAAR RNRSSSKAAG  180
SRGTQGKAAG GVGVATEQHQ LQPTGAAAAA AMTDSATGAV GPAAAATAAK QRGGSGGKRK  240
RGGEGAAAAA AVAAAAASEG ASGKPPPAKK AAKGKQGCSS SAAAKVQPDP SRLLMDLYDV  300
ADGGAAAAAT SSFLAGGGGA TDDATAAAVA AAVAAAVAAC GGGGGGGGSG GDGAGGGGGG  360
GFSGLGFGGF GDLDFDLNGD DIVSGSDAGE GAAATAGGAG GAGGAAAAAR RAATATTAGG  420
GEAMSCGEEG QATSAGGTTG GGGGGGGGLS TGAVPGEDPE KAKERREKNR IAARKCRAKK  480
VQMVRHMQEE LKELVSANHE MKTQVVTWHR MFSREVKLRE AMKRLILAVW GQPAARATGH  540
TANDVIIGLE SGTLDINGVS AMLHAAGGAA GPPPPHPPPP QPQPQQPYPA AGGAAATGAL  600
AAAAPPPPMP PGAGGSGGGA VVAPLPPGGG GAGPRLRPGP AALDVCGLLQ PPVLLPGGGS  660
SSVGGSSDGI MPPPPPPSLL PGPAGGGSGS STGNGACDLT PYPHAGRQPQ QPRTPLRPLQ  720
LPLPQTGSVS AAAAAAAAAS AAAAGPTSPR GVGSPTAAAM VPGAFAAASG GGGGVSSPFA  780
AAAIPRSPFA VGAAQASVQQ SELLAAAADV HSDAAVMPDA AAVPPPPLAP LPPPALPALP  840
SGGGSRRLPL LSSPFGSVVS PFPAGHGEEE PLAPPPLAPP PPPLSPASQR APRVGGGGAG  900
VSGFSPVANA SPFACMAAAG AADTAASDGT PPTPPAHMLA VNMTAATAAA AAAGAGATAA  960
AGTGGDGGGA AAQPGTTPSA LYSSSRLGGP SATASTLPVP AVAGTSSGGG ASGGGASGGD  1020
GDGDGRGGGG GGEGGVGGER ERSAFHAFSM GLGNGSLGPG VSLGLAALPS LEASFSLARL  1080
LSLQAVGGGG GGGGEAGGGG GYGGGVGDGG AGDGGGGGER LRLQEALRST SLGTLIQEQQ  1140
EQRAQAQQRE GQGHQSQQQP HHDHQTPLEA WLASLTNGGG GSGGGGTGGS GGGGGGGGGG  1200
SSQGTAAGAA VITPKAPAPP PPPQQQQQQQ QQQLQPAAVL LPSMRLPSLN LEGAPSSTLM  1260
ALSDPGLLLL RHDSGGMDWL AGLQQQGLQG LQQQHQQNQN QPQQQPQSQQ RGLGSQCKPR  1320
EEPHQSHQSH QNQQQQQRAA RSPPRPRSPR PPAPAHIKEE VCA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
111891200SGGGGGGGGGGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre10.g454850.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP890844