PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre10.g453500.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family Nin-like
Protein Properties Length: 1300aa    MW: 136323 Da    PI: 6.2241
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre10.g453500.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK23.89.2e-08158197948
              RWP-RK   9 dlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                         + s+ F  ++++ A+ L+++ T  K++ Rq+G+  WP+R 
  Cre10.g453500.t1.2 158 EASQGFTSSLAATASALQLGSTSFKKKARQLGLCFWPYRA 197
                         56789**********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151910.512134221IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1300 aa     Download sequence    Send to blast
MSSRASLRAA STGAYGSQQD GQQRAEGGAD EQRLVQEEGN NRPAVAAAAA KPAAGAAGAA  60
GGGDALDVDG AQDAWGAGAA REEEAEAEEG DREVAAAVRD GGGGGRSGGR GGRGRGRGGR  120
GRGRGAKPRG FPVPVQQTCV RRLAERAAIE LSVDVLREAS QGFTSSLAAT ASALQLGSTS  180
FKKKARQLGL CFWPYRAYQR LTTLTDSYKK EIEDLEKEAA TLPEPPPPPP PPVAAPPAAA  240
AAAAAAGLPP LPPSLLGLRL PPPLLPAGSA AVAGSTAQAA APVQAMQRFL LSLPSALAPT  300
NPAAVRAQEV RQLIAELKSR MAECEAWWAG FVAAPCRDAG FKLQKDPFFR KIQEWTRHTY  360
KKTHRDKVRS LCGEGGAAGG AAGGGAGGRK RRRGARAAGD DDDGEEEEEE EELDGQDDSS  420
DSDEGAAEEY DTTTLSEEEQ EQDEKEEEDE KEDDEAGELH EAESEDGEAG SRRRGRPPLK  480
RQRQPPPPPQ PPQPQGQQPP LQQRRRQQQQ PQPRRRPVIH SFPLPSASRR GGRATASPDA  540
AADGAGGDGG KGIVASTAAA AVEAPAPQAV AMAAAAAAAG GMGFPPPLQQ HLQVLAAAAA  600
EAPATAPASA LAAQQPQSQQ QDLQASHRRR QRIPITAAAA VTPSAAAPAA AAGTRAVASA  660
AAVAAAVAAG TRAALDIRRS LRAAAAAAAA SAEVPWAAAT APVTAEAEAV AAADEEAWQD  720
VRDVDMDDTE VAAAAATAAE VPPPPPPAVE PPLLSPHAAV EPPPPPSAAG VSPSVLAAPA  780
AAGDACTGGQ SSACGVPQVI SSLTSKRRHS REQAQEQQQQ AEKAEVERQR QQQQQQQHQQ  840
GQEQEQEQEQ EAVARPSYCS RGKRARSGSP AAGAATAAAA AGELPPPHPP QLQPRRSPLG  900
EMGAAGAAPQ VDEACAYGGG ATAVCDDTHD LQQQHLLQPS PPLQQLPSPQ QHQHQHQHRH  960
QHRQEREEER EGDRKEEQEE EQESSAAPLA AATPLLVPAA KPPPPAVTSM AITYTPLSSS  1020
LVHASTRAAQ SQPPQHLLPP PPLPRELQPP PAHCYQAPPP SPPPAAPAAA PDPPPPGPTP  1080
PPVAPPGAVF PLAPPRPSDP RLPQHLLGPP LHQHQPQPVE EQQHLQHQQQ PVAAPSAQTE  1140
SCLQPQPGQP QQQHQQSPHH QQSQNQHHQP PLHPYHQHHQ PPPPPQSQHQ HQPQQHQQPQ  1200
EPLPPQHPSL PPHQHQHPHQ HPPAASAAPR ELVQQLAVLR HRVSALEWEV RQRDGQLKEA  1260
AHAAEVAALK IKVAEQQAAL ERMEVERLRR ELQLLQEQL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116124RGGRGRGRG
2387393GRKRRRG
3388392RKRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre10.g453500.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3DBC20.0A0A2K3DBC2_CHLRE; Uncharacterized protein