PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre10.g435450.t1.2
Common NameCHLREDRAFT_205871, CPL2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family GATA
Protein Properties Length: 437aa    MW: 44368.5 Da    PI: 5.0322
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre10.g435450.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.91.2e-17380414135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C+nC++t+Tp+WR gp+g++tLCnaCG++y+k  +
  Cre10.g435450.t1.2 380 CRNCRATETPQWRCGPEGPRTLCNACGVRYKKGQT 414
                         ********************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011413.929374428IPR000679Zinc finger, GATA-type
SMARTSM004019.7E-13374431IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.7E-13374420No hitNo description
Gene3DG3DSA:3.30.50.101.5E-13378413IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.29E-12379411No hitNo description
PfamPF003202.9E-15380414IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MATSGNGVSA LASAAPETWV PTMTCAPRPS DSCLPASAAE LREPVTSTIG RSTSPFDAER  60
PSCPHLPAMG HLTPHQAPAG LAPTWGESSF GIHGLAGGEC GGGSMWDCEP VAPAGPSAEG  120
LDALSFAFMQ SQQPHDQLIS RPGLSVTEHP CTLLRAPSGG YSLINTASIA AAAPLDAAAV  180
ILPQPAAAAV PAAAATPACS ESRTSPTPST DQQQPDATSA QTSSGATSSC GGSDMPENAA  240
AEVQQRAPEA PPAPLPLPQD AQASAVPSVA VEVVVEEEEE LRPVAVQQVG PPGTAALAAM  300
RASGRMALAA VPARVGQKRR AAATAAAVVL EAARDDEDDD EDYDEREEAG GAAGRGNTKR  360
MKRVGVPRTT TNKPKTGVTC RNCRATETPQ WRCGPEGPRT LCNACGVRYK KGQTLEYMAK  420
KAAAAAARGR NGGGDY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.102680.0normal conditions| nutrient deficiency
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre10.g435450.t1.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001690411.10.0transcription factor-like protein
TrEMBLA0A2K3DA580.0A0A2K3DA58_CHLRE; Uncharacterized protein
STRINGEDP056700.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2201430
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.25e-12GATA family protein
Publications ? help Back to Top
  1. Merchant SS, et al.
    The Chlamydomonas genome reveals the evolution of key animal and plant functions.
    Science, 2007. 318(5848): p. 245-50
    [PMID:17932292]