PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre09.g413050.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family bZIP
Protein Properties Length: 1054aa    MW: 106414 Da    PI: 6.9189
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre09.g413050.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.92.5e-094785271059
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                          +kNR+A+rr+RqR k++++ Le++ ++L  + ++L+ e+e+l+ +   l
  Cre09.g413050.t1.1 478 QEKNRSAQRRFRQRQKEKMAYLETRTEALAVQVEKLAGENESLRSMNGML 527
                         58*******************************99999999999987655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd146886.71E-11459534No hitNo description
SMARTSM003380.002473533IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.38E-8477531No hitNo description
Gene3DG3DSA:1.20.5.1701.6E-7478531No hitNo description
PfamPF001701.5E-7478528IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1054 aa     Download sequence    Send to blast
MQPGDDDAAL ESYLDAFMGG SGFGGGGPVL TSSSFGQQSV AAPNGGFGMM QHQHQQQQQP  60
QLAGQMMGAA SGPGMQPVMQ PGMLGRPAST GVMMGQVSGQ GAMGGFGMSA GGDVDTSNMT  120
LPQLQQLLRQ RQAQQQQQQQ QMGFGAGAMG GYGGMGGVGG VLRPTSLQDH LTGGLGAGGM  180
APDPSQWRPA LGVVPSATGM QGFATPGSGQ FGEGMGCYGD SGAQSMFNTG LAAQQQAAAA  240
QQQQQQQQQQ QQLQQQQQQH AAALQAQAQA QAQAQAQAQA QAQAQAQAQA QAQAQAVAQQ  300
QQQQQQQQVQ IQAHAQHVPI PVGGIMRPAS DSLLVNQRAS MGHMGLGLSG LGQNLASHHH  360
HHQQQQQQQQ QAISGSHQQQ PQPQASGPSV TIRPNSLSAQ TGAGGGGGGG GGTAGSGGNA  420
SAMTGTAAGP GGGGHGSKKT TWDAAAVAEG SDDSSAGEDS TQRRRVKGRS AAAPSLQQEK  480
NRSAQRRFRQ RQKEKMAYLE TRTEALAVQV EKLAGENESL RSMNGMLEKV LNLREEHISN  540
LQEAAKVFSG LNLGSGEGGG GGGGGAPDPS DPAYKAVQDA VTAAAHATAA SPAGGGVGGV  600
NSFSAGGGLL SLKSEEGSGG GGGGGGGGGG VGAMMDASGA GGGGGGGSSG GMMLPGGGHA  660
LPGPGLGMEA AGPGTRFTAE AIRAMSAEDV IEAWKENLKE LSRYVVLAEN NPPGQALPPG  720
VLSRITQLTA AMSELVHKVA MISPLAAKRL LATNMELHAM VPVPEPHWAR VLHLLGLGEQ  780
QRRDLLGARE RFLTKFEAVV QERVGLVNGL SQQAIPRSRV YADICASSLA AHEAADRLRA  840
NLQREHNINM EFVVFVFKGV LDLLQVATAA VHSYPYYPDV LAMANVLHAQ QGGGTAGTAA  900
GGAASTAGGS QVNTGVMQSP PLLGSTHSPS TTPQQQQQQA LAAQLAAQSL QTSLSGGGMG  960
SGGAAGGSGL QGAAAGMYGG MQHQQQQLTS QAGVSGSMGM SGMGIGMSGM MAMGGSGLMQ  1020
QHQQQQQGHP NQGQQGQGQQ GLSGMMDQDT AGT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1637647SGAGGGGGGGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre09.g413050.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002951098.11e-161hypothetical protein VOLCADRAFT_91555
TrEMBLD8TXD71e-161D8TXD7_VOLCA; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP190466