PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre09.g410450.t1.2
Common NameROC15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family G2-like
Protein Properties Length: 632aa    MW: 61204.3 Da    PI: 9.0622
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre09.g410450.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.11.4e-26392445155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH++F +av +L G++kA+Pkti++ m+++gLt+e+v+SHLQkYR+
  Cre09.g410450.t1.2 392 RPRLVWTPQLHRKFESAVIKL-GEDKAVPKTIMQEMNIDGLTRENVASHLQKYRM 445
                         59*******************.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.663389448IPR017930Myb domain
SuperFamilySSF466894.3E-17390448IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-26391447IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-22393446IPR006447Myb domain, plants
PfamPF002493.9E-8395444IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 632 aa     Download sequence    Send to blast
MAFDASGALQ SCYGAKEDAN MDPAAGLVPL TSSLIPPLLA HAFALPQLAQ APAPAQLQPQ  60
ATAQGYYGSM LSPALMGALG YATGASYAPV QQQQPSHLAS LQYGYLHALA TASQQQQQQQ  120
QQQQHSAAAL LAHAHNAAAL AAVRAGQATS SAMSHPLPPA ASADTGSARG AGPSASEPER  180
AASASVATNS SGSALRGSSA SYGSAAAAAA YAHPLMGLYA ALSQQQQQAA AYGASPANSY  240
GAMAPFTTHL HPAYYARPQD AGQAAAAAAA AAAAAGAYGY AQPTASYGSS FGHPASSYGG  300
APSSILDFSS SLAAAYRPVA MPAMPAASAL AAAAAVAAAA GAMPQTSQSV GMTGAVAAGG  360
GANGAVSSLG GGAAGMMGEE YADDGTTRAV KRPRLVWTPQ LHRKFESAVI KLGEDKAVPK  420
TIMQEMNIDG LTRENVASHL QKYRMIKRRD VTGTSSDGGR DSGTTAAPTS AGTAAAAQRQ  480
AQQQQQRPSD GATAADGTAG CSPAAVSSPA VAAAAPPSTA AAAATPSAPH SAHKPSTHGQ  540
GSSGSGGSGC GGSGSGSGGH GSGSSARAGS KRSEPEPPSR PTPQRAVAVT EAALASSAHP  600
AGSSGSGRNS AGGSAAAATA AAAGNGVAVM A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A8e-22392445154Transcription factor LUX
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.105650.0normal conditions| nutrient deficiency
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre09.g410450.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3639640.0AB363964.1 Chlamydomonas reinhardtii ROC15 mRNA for RHYTHM OF CHLOROPLAST 15, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB1B5J30.0B1B5J3_CHLRE; RHYTHM OF CHLOROPLAST 15
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Representative plantOGRP11571753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.11e-24G2-like family protein
Publications ? help Back to Top
  1. Matsuo T, et al.
    A systematic forward genetic analysis identified components of the Chlamydomonas circadian system.
    Genes Dev., 2008. 22(7): p. 918-30
    [PMID:18334618]