PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre09.g387850.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family Nin-like
Protein Properties Length: 1758aa    MW: 165167 Da    PI: 8.9862
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre09.g387850.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK506e-164795452
              RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                        ++sl+ l+k F+lp  dAA  Lgv  + LKr+C ++ I+RWP+Rk++sl
  Cre09.g387850.t1.2 47 DLSLDALRKVFHLPCVDAAAALGVAHSKLKRRCHKLRISRWPQRKLASL 95
                        6899******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.18730115IPR003035RWP-RK domain
PfamPF020429.0E-184895IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1758 aa     Download sequence    Send to blast
MVKSKKPGEK KKTRADESGD DEDFGFDGAS DSGDDAADRL LPGGAPDLSL DALRKVFHLP  60
CVDAAAALGV AHSKLKRRCH KLRISRWPQR KLASLVFLRD ALPNDPRLTE PQRAYIVTKI  120
DDEYGRVMRD PNHPLDKELE QLRKSNYKLN YNRKLKQANK RGGSPADDLD APPPRSSGGR  180
RAGPRGGSKG DLAGGDGGSW RSPTSTGGNS DLGGFGGAPL GGLPLGGLGG GPGGGGGGGI  240
DGPMPAIPTL MTGGRGPRVG PPGPLSLAAV GGGAGTPTAS GADSGGGPGG PLALPPSGGL  300
GLGLGLQLGP GGGGGRGGGG GPMGYVGGPG DLGPGPGGWD GGPDDDMHGA GGPSLLLAGA  360
GGMGGGMGGG GGGGLYPTHS EPLPVGVGGG SAASSPRNLV QRRLGGVGSN SGHGGPGRRS  420
SLERMALLSV VADGKVVKQA SRRQSGSGSG GATPQALGLQ APGSPRGSGP RSPRALPRAM  480
ASPGGAAGRE GLLDSMWGGG SGGGPGQQRG GGVRGGMPGD GGWIGPPSGG VAGGSGPLGR  540
PHSPDLGPHM GGGGMPLQAL QSGGSGYGPA HSGGYGGPGG GGGDMGAGPG PGPGHYNDMS  600
GRGHHDSYGS APGSYGPNSA SGGGYGGPGG GGGGQGGGMG GYGGGGGRGG GYGPGPGGGG  660
GAPGGGGGGG LAAAGVNAIL GDADVAILAG LSHRPSLGME QLSAEELALL GIQGADRDLL  720
LDPIADASLD PLVDLLLLGD ALGGNGRGGP QGGGGGGGAA ADGYSAQRRI SEALAPLLGG  780
GVGGGLGGGG GGGGGGGGGY GGDVMAGPVG VSSLLRHPGG GGGGGGGGGL LAGVSAGGSV  840
SAPHRQHRLS SVTGAGGNGP QQRTSRFASS SLDGPQQHQQ VPQGQQHMQQ HPHQQHMQQQ  900
QQGPGGYGSR GPGLGPQRQY EDEPCGYGGS GGGGGGDGGG YGMDGGGGGG GGPGGYQSGM  960
GLGGMQAART SLHGLGGTAP GYGPGSGPGG GGGGGGSDYG RRMGGPGPGP GGLGGNPHAQ  1020
HLFTEGRHSA PGHIGIPGWD DQPGGGGGMG GPGPGGGGMA GGGGGGWHEG PDDCRSRGVQ  1080
GGMDSGLGPE GQFMGRGGGG GRGMATGYGG SGSGGGGGGW FDRGGGGGGG GGPMGSGSAG  1140
APPVPQQYRG GDYSGPGGGG GGGRGSMGGD VAGSAGARPS GMSAGGSQGQ GPMRRGMDPL  1200
DGDMPPAMGG RGAPPRRNSF SERMGPGGGG YGGGGGGGGG GGYGTGYGRP NTANGGPDSG  1260
GDWGDRGGGG VGGGGGSGQL GQPFSRQEQQ SAREQLARAM MRGGSSNGGG SGGPAALLAA  1320
QGQGGNSGGG AGSGRTHLSG ALTGGPTGPH GGVNSPPPET IASLQGLRLR NEMDDYGQRH  1380
PQHYQQHQQH QQHPHQRDMG GPGMEQQAYR QQHQQHQQHQ QQGPPHPHSH RRQQQQHDPP  1440
HGGYDGRQPY RGPPGGGGDG PRTGGRYNDG YGGPGGPGGG GGGGRYDAGP GGGRFEGGGG  1500
GGPGGGAGGG YYPGDPSGGR GAGPRRVSDS MSGGAGGGRG GGAGGPGGGA GGGPGGYYGG  1560
GPSPGPGAGG APRFSRTSDN MAVGGGGPGG GGPGPGPGGS GAGLLEALDH QLEGIDAFVD  1620
RNLDLLRRNS GGFGSFMAEM GLGRGDLGGL SFSGAGGMSF TGAGGGGGGG GPNGPGSSMS  1680
YGPGPDGVGG GAGPGGGGGA GLMGGLGSMD LETMRESLRR ELRQGSMEQW DDMVRGLGQP  1740
GPGGMGGGGM GGGGGGY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1985996SGPGGGGGGGGS
214911499GGRFEGGGG
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre09.g387850.t1.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001694534.10.0RWP-RK transcription factor
TrEMBLA0A2K3DDQ80.0A0A2K3DDQ8_CHLRE; Uncharacterized protein
STRINGEDP025290.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-09RWP-RK domain-containing protein