PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre08.g358532.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family GATA
Protein Properties Length: 470aa    MW: 48122.5 Da    PI: 6.905
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre08.g358532.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.62.7e-16395425131
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyr 31 
                         C  Cg+t+Tp+WR+gp g+ktLCnaCG++y 
  Cre08.g358532.t1.1 395 CLECGATTTPQWREGPMGPKTLCNACGVRYV 425
                         889**************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5103816.08841194IPR001025Bromo adjacent homology (BAH) domain
SMARTSM004390.009241194IPR001025Bromo adjacent homology (BAH) domain
PfamPF014265.5E-1142192IPR001025Bromo adjacent homology (BAH) domain
CDDcd043702.10E-1143126No hitNo description
SuperFamilySSF577165.7E-13387428No hitNo description
SMARTSM004011.6E-11389440IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.69389424IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.3E-14392428IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.31E-10394449No hitNo description
PROSITE patternPS003440395420IPR000679Zinc finger, GATA-type
PfamPF003208.8E-14395424IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MMAQAQPPQQ QPSLQVFLWL GAGQQRADGR IQYSSFRLNS TDYRVGDCVF LFPEDESYPP  60
YVARILSAFV DTQVQEGSDP HCIEVKWFER RVNLEPTTKG IEESEREVFE LEDTDVNPIG  120
CISGKCRIVK AHNYEEARLR RSAAATGGSG GGAGGAEAAG AGLGPSGPGP SSADPWFFCR  180
GYFQQTTNSF VAYTPDEMAR PDVALDVGLV DTAAHAHGAG AGAGHLAGLA GPGLGGGGAG  240
LSEQPPTPTR LRGPNTAAGS GPVWGLPHGH AGKAAALHSS HHSQHPHAGS GADPHHMADP  300
GEAGVCWGAA GLDGEGGDGG AGPEDDEEYS DPDNNHNDNR GGGGGGAGAG AGGRNHHYAG  360
GASGGGRARA AGGHHAAPAQ QQPSSKKQKA TGRTCLECGA TTTPQWREGP MGPKTLCNAC  420
GVRYVRSQQK AAGQKRGGHK NGQKTDAARG QGARTKRKPH HGGGSSGED*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre08.g358532.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGEDO963711e-43(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
ChlorophytaeOGCP2201430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.17e-13GATA transcription factor 9