PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre07.g321550.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family bZIP
Protein Properties Length: 394aa    MW: 41430 Da    PI: 5.5822
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre07.g321550.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.86.4e-10180224347
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                         + +++  +++NR+A++++RqRKk e+  L++ v+ L+a+  aLk 
  Cre07.g321550.t1.2 180 RQRNAEQMESNRIAQQKYRQRKKGEQSALQTAVDLLTAQVAALKA 224
                         56778899*******************************999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0022174245IPR004827Basic-leucine zipper domain
CDDcd146866.04E-7177224No hitNo description
PfamPF001702.8E-8179224IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.53E-5182224No hitNo description
Gene3DG3DSA:1.20.5.1703.5E-6182224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MERFDSQMLF SVFRNDEGEN LLPFDELAEL LQMDLAPNGD AGATPASFAP DAALPLDLPH  60
LHHAPPIITA PLVTTAPPTG PIPSDERAAA LTHQSTLPSP SGGSSDHTRA QNWAGSNPSS  120
EDGDGDGDRD GRDGDGDSGD SDMDHTTQTP GVSGAGDAGG RGRRGSSKGG KASSGVKKRR  180
QRNAEQMESN RIAQQKYRQR KKGEQSALQT AVDLLTAQVA ALKAVEVRNG ELEAAAAALQ  240
STVSQQAAAV ASLQQHSAGQ AAELEATRAA LGHSQQQVAA QHRIIVDQGT KLRLQEQVIA  300
SLKDRLKEEI DEALKCVAPN TVCEKMVAAV KAALYGAKDV SGLQDVLSQL PEHLVHDICK  360
NIWQVCKESW PDLRSRCATL HAAGCPTSGF GTA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.100930.0nutrient deficiency
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre07.g321550.t1.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001700854.10.0hypothetical protein CHLREDRAFT_187531, partial
TrEMBLA8I7540.0A8I754_CHLRE; Predicted protein (Fragment)
STRINGEDP071080.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1009533