PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre06.g297150.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family Nin-like
Protein Properties Length: 1902aa    MW: 186356 Da    PI: 5.8423
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre06.g297150.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK68.41e-2117661814452
              RWP-RK    4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52  
                          +i+l dl+kyF+lp ++AAk Lgv+ T LKr+CRq+G+ RWP+Rk+ sl
  Cre06.g297150.t1.1 1766 DITLADLRKYFELPNQEAAKRLGVSGTHLKRKCRQLGVLRWPQRKLMSL 1814
                          79********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.08717491834IPR003035RWP-RK domain
PfamPF020425.6E-2017671814IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1902 aa     Download sequence    Send to blast
MLEQRSAGAG IPDMAGVHAP PPAEAGELLY ASRLKTGPAG NAAAFATSVQ PPMHGTAADK  60
SAPALLTAQR GGNGTHAGHG TAQPQQLVVD AGSGGYGGGE VDAPPAGIRT AAAVAAMAAV  120
APAASDAAGL VQQQRQQQPS ETGAVAFTSP TVTLAGVGLS HGVAAGLPRL PAAGDTQLAC  180
AASADTSTAL PGLQWLRPGC SEGAGHGAPL PLVESEVTET AAAPGAAAAA AAAAGDAETE  240
DEAETEDADA AAAAITHGAV QVAGAGQVAA ARATMQDVAE EQEAAAAAHA PDPRVVAAAH  300
AALPVPFRAD GPGLGFAFDD GPRLPGPGAA GAASGTGVGG GVGGVGGDGD RRLHEAGAQA  360
AAMDAAGDTA RPPLHPLQSE PRGTAAPAPA EAAPGARAQS PQPPQPPQPP QAPQPPQPPQ  420
PPRAQPDDAD DAEAVELLLC MRQTSAAQPM DLGDLDGAVA APAAGAARPM TDAGAGPGSP  480
HDVDTLGFGG GGRGGGDAEG AATSSAGGSG SAGGGGGAGR GGRGRGRGRG RGRGRWGRGG  540
GGRGGRGAGT PSARTSGAGT STPQSHEAGY RGLPRPHGST GGDPHDRDND RGPDAEDAAD  600
DDDNDHENDL AVNPLEPLGR GHQLRRLRPR LDAAIGLAAP PHALLPHLSV PQHMAAATAG  660
FAPSGPGHLH PALSAPMPLS ALATGLSGGS GSGRPAIAAA ACSTGSGVGG GSGNATGSHV  720
NRARLLQILN LATKQQQQQQ QQQQLQAGAA AGRGTMTPAR YRESLQRLQS RRHQLLAQQQ  780
EITRQLLAIE EEEAALKAGM EEAAMAELGA AGAGLGLLGG GLGLGLGMGV AGGRPGLGVD  840
EDGEGGGGSG EAAEPAEGEE EQLGRGGAGV GAGVLPSWAA AAAAQLHLHA ALGTPQRSAA  900
PQRPPAAATA LAPHSQPKPQ SQARPQSQPR PQHRPQQAAR QQAAEPPLAS VPAGPLAPRQ  960
QQQPPADLVP PGLAAWPNSR LLVADGGVAE DCGAQTAAGM DTGTPGTEVP GAAAEAEAEA  1020
EAEMAAGLAL RQGGAAAAQA LADMKAEGPA GDAPAGPAGP LGADGAAAGG GGVLSLDAHR  1080
GSSGSSGSGA AAGALRPLLQ SPSRLQLELE LGGALRQQGQ LKQEHGQEQP QQQQPHLQQP  1140
PPPPPPQQQQ QQQQQQQQQQ QQQQQHVQQP VLEAGASERR VRPRLGPEGG SEAARQQARP  1200
PGRGGDLDPP PPAAAGNVEA LLGSAAEPPA ASLIRLQQLQ QLQQLAALQA LHPNQQPGLA  1260
AAAGAAAAAA AAAAAGVESG DATAEQQPQL LAQQSQLQQL HLLQHIAAQQ QQQQQQQQQH  1320
QANSFRPQPQ LQLQPSQSLP LHSAGGGGAD GGAAEQMVSL LQRQLLLQQL QQQQQQQQAG  1380
LGVSPAQYRS EADAAMLAGR RADLGGGGSQ PLPAGVAACE GGGAAAGGGG PGLRSLPVDL  1440
SLLPPLMQHQ LLLGLRLGRA ESVGSGGGGA GMAGPGAGVG GGMQGLGLLG ALGPHELGGG  1500
LEDGGGAGGG GVLAALLPPR PSIGAGAGGV GGGDGKKLPA KRGRPKGSAN NTSSVFDVDY  1560
SLTPAQARLA EAAAAAAAAA ALTSGTGAGA LTNGTGAAGT ATMVRGGSTA TGIGASGTVE  1620
VSGKRGALKP QPQQQMTVAG PAAVAAAAPS QPAQPRSQPS QPQTQSQPQP PQTQQQQVQT  1680
PRPPQPQTSQ PQSGRGRKRS SSGRGAGGSG GSGGGGGGGS GGGEDDSDDD DDEDDDGFDG  1740
PDDEGEGLGG GGGGGSGATG RGLPADITLA DLRKYFELPN QEAAKRLGVS GTHLKRKCRQ  1800
LGVLRWPQRK LMSLRALAAS IQSDARLNEE SRQALLAQVA RNHQSIMDDP NAPLAAGLKV  1860
TRQVQYKQTF DRRTKGSGPG CGGGGGGGGG GGGGESGSGG Y*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1524533RGRGRGRGRG
2524534RGRGRGRGRGR
317081719SGGSGGGGGGGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre06.g297150.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3DQN80.0A0A2K3DQN8_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-14RWP-RK domain-containing protein