PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre06.g291500.t1.2
Common NameCHLREDRAFT_195860, RWP6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family Nin-like
Protein Properties Length: 939aa    MW: 96119.1 Da    PI: 5.3096
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre06.g291500.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK54.81.9e-17726770549
              RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRki 49 
                         i+++dl++y++ pik+AA+ Lg +++ LK iCR++G++ WP+Rk+
  Cre06.g291500.t1.2 726 ITVDDLRHYYEVPIKEAARRLGYSVSCLKNICRRLGVPNWPSRKL 770
                         899*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.335715793IPR003035RWP-RK domain
PfamPF020421.0E-16726770IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 939 aa     Download sequence    Send to blast
MASPGMEAPS VDDLIRRSQC LNADDGDREL LELGANPDLL LTSQPDVWMA ADRGGGDGGD  60
SYDADPAHQA LRHLPTAVAA QPAGSGQVMA FSASPASAAV GAAATIDALL RSPCGIANMP  120
AAHASDWLSA PAVFGNAVLD SAIPTPAQVL TAAAAAGRGG DAAACGGNMA AMRLDQQLLA  180
ELPCISGPAA LPSFWGGRTG MTTVSAAMET SRGGLLLSGT AAAGGAFSSS ATHGRPSSSA  240
MLLQPPLLAQ PTCMPQLPAQ TGGALLFRPP QPQPQSGSCT DAVQLAKEWR SGYDEFLMSE  300
GGPAGDFLDW GGGCGAAMPP PPPPPLQPYS GSNYSSAGSQ QLQQSPWSTG GALQAVAAGN  360
NSLTLLHTVG GRLAHMQQGR QRQGPAQTLS ASGAVAAPGF TSGVIGQAFC TSANATATAT  420
AVAERLRTRK QKHAQAPMVG SSPRVLDLLE PEPAGVGASG TYVLGPDGEP PREYQRSLQQ  480
PASASQLPRL SQPASPLQLR RLQHPQPAQS SQPLPLPLPQ SAPLLQLPPP LRPPEPKEPA  540
AWRQQAPAAP AAAEVGPAGT GDVHVVVKLD VPVATAVSQQ AYTGVGAAQL RLVEAMDVQQ  600
EEQEKVEEAE EDPEPGAEKM AAPAGAAKGA DSGAKSWSSR QGPRAAVGHK AAQAREKARA  660
AVGWPLEEAA GVSMGCSSGG GGGNAPRASP EQDDEDDGCC DTGAADDDDD DDDDGPAGNG  720
RDGRVITVDD LRHYYEVPIK EAARRLGYSV SCLKNICRRL GVPNWPSRKL LTLQKMRGAL  780
LGADAAANGI RAGGAGAASG QEAAEARLER ERLLERLALN IADIYADPHT PMYPEFMRVR  840
QLQYKSRANA RLARRSCSGR AGGGSISSSK AADSSRSGSK AADGSGSGTE GGGRGEESRG  900
RAAGGVAKRR ARRDRSLRGI CEDTKEGSEV MEGSQDME*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre06.g291500.t1.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001695529.10.0RWP-RK transcription factor
TrEMBLA8J2J30.0A8J2J3_CHLRE; RWP-RK transcription factor
STRINGEDP017870.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP609428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.19e-09RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Merchant SS, et al.
    The Chlamydomonas genome reveals the evolution of key animal and plant functions.
    Science, 2007. 318(5848): p. 245-50
    [PMID:17932292]