PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre06.g285600.t2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family Nin-like
Protein Properties Length: 1332aa    MW: 136021 Da    PI: 6.8936
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre06.g285600.t2.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK57.13.5e-1811311176651
              RWP-RK    6 sledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51  
                          +le+l++y++ pik+AA+ Lg++lT  K  CR++G++RWP Rk++ 
  Cre06.g285600.t2.1 1131 TLEQLKRYYEQPIKAAARALGISLTCFKGVCRRLGVPRWPGRKLQT 1176
                          79*****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.27811111199IPR003035RWP-RK domain
PfamPF020422.6E-1611311176IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1332 aa     Download sequence    Send to blast
MLDTFDSLVA GLPMLLDTDD GPSLEDLLTG ASSAPQLRTR QEAAEKMILG TSDLFLDSVP  60
DLWMADGAGD SAGGCGNGGL LDGGGLQRSQ QQQTHRTLLP AAAEESRVCS GAATPPAAAI  120
AAPSEALGSH VPGGESNAAA FSRGQGLRLQ QQQAAGPAAG IAGGAAATAC GLGAALDAAS  180
SRMRIVSSSS QALFHSTASP AVCLDRSASS TASAGAAAPA APAPPVTPAA AAIARLMSYT  240
QPPPPAPAHA AGPVRIAAGS SRAALLLSPR AVAEMPARYD GCLSVPPATF SSTTSWNPWR  300
PIPTPAEVLA AATAAAADGG GGLAPTRFGD CLFGRAAGAH CISDPVAMPS LRIASSAEVS  360
ALKANGAGFQ HAYPGGGGFG GGSALATASS WHASCSAMFL EQQQQQQLQQ SSLPQLPAAG  420
FGDGELSHRR LLPLTAANPL GGNSKRRHDG GGGFLLPGPG QRRGAAVDGM DDFLDDWGAG  480
PAGCWGAPLI MPPPALCAPP LLPNDHGGND GGKGAAGGSG SQISSLRSAW STGVLLRQQG  540
SAPAHVVSSS SLQQPHGSPA PPVAAAALHV HQQHDWQQRL IAVSPAAVAA AEAAGGDAAS  600
SSGHGSGLGN SAEAGPMRLG PMQQQQQQQQ VEQQLQQLQQ LQCESLLHRR WLPDGGGGGA  660
APASGSGATC GPGSREPARW PPVAVESICC PPCQQLPAGF TPPLTPPLDT MDRVLTSLEQ  720
IKLQQFQQQE RRQQQQQQQQ QQQLAAGWSG GPQAQQQWLP QQPQPLGHQA HTAAAPPLRI  780
QLEMELEALA VQGPLLSTPR GDNTTTHSAL VVAPLPHDFA ATCLLGQQGM GSAADDAGGA  840
CWVRGSSSRV PLDSSSGKAT YEPSAGAAAA LSAAVAALPP AAAGGAAPRG IERQLDRPAP  900
LGPQQQQAAQ QQGADACCGR RGHLMELRGI GASGTYACGL EDHVMPLELQ QQQRHLQQQL  960
PRPINSTDVE KLVPPADGCE GAAAVRRAEE RLQLLSSGGG LRVLHGSTSS GRVPSEYLKP  1020
AAAAEKQGDG DSRALPTKAR DAAASAVDAG LPRKKRPGAG DKAAQLLARA KAQAAAVDWP  1080
LPLPAEAKRS GRSTGAPRVK EEDEDGEWMG DEGPLVAVAL LGEHPLQQEP TLEQLKRYYE  1140
QPIKAAARAL GISLTCFKGV CRRLGVPRWP GRKLQTLKKM RDTLLQAGVG GAVTIECAGG  1200
AVISPAEQTD LIAKIALNIS DIYADACTPM YPEFTRVRQL QYKTRSVARQ GRRGGASGGG  1260
GAGRKGAEGS DSSDGEGTVT RRTTGGAGVG KRGGGVVKRR RRFSERYSVS SDEEASEASE  1320
EPDAGEVPQE D*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre06.g285600.t2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001695357.10.0RWP-RK transcription factor
TrEMBLA0A2K3DPY00.0A0A2K3DPY0_CHLRE; Uncharacterized protein
STRINGEDP016150.0(Chlamydomonas reinhardtii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-09RWP-RK domain-containing protein