PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre05.g238250.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family bZIP
Protein Properties Length: 525aa    MW: 53624.2 Da    PI: 5.3337
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre05.g238250.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1444.7e-14238297362
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                         e++r+rr++kNR+ A rsR+RKka   eLee+ k +e+eN +L+  le+   e  +lk++
  Cre05.g238250.t1.2 238 ERRRQRRLAKNRVTAARSRERKKAAWSELEERLKGIETENAQLRAMLETFARENTALKAQ 297
                         789**************************************************9999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-12235300IPR004827Basic-leucine zipper domain
PfamPF001703.1E-12238297IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.921238301IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.9E-14240299No hitNo description
SuperFamilySSF579593.38E-10240298No hitNo description
CDDcd147042.44E-18241291No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0010224Biological Processresponse to UV-B
GO:0031539Biological Processpositive regulation of anthocyanin metabolic process
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003690Molecular Functiondouble-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MDVDGLDLAA LLAEGPDSGV GPSLLDDELF SEDLMQFLET IEGQPTSTQC HQKLAAQQQQ  60
QPVPAPAPAP APAVPIPVAT SSPAVAMSPT ASTSSGCSSG VVAAPAPIPT PVAPAAAAVA  120
LAALQQAQMQ QLQPACAAML PRLVTTTAAQ QMWTAMLQAA CTVTPALAAA HAPAAASVDD  180
AKARAQPAGT SRQGSREDSG DSSDTDQDDD MVDSKGKSVG NKRKAPEVDW RQIEDPAERR  240
RQRRLAKNRV TAARSRERKK AAWSELEERL KGIETENAQL RAMLETFARE NTALKAQLLT  300
VAAAGGVPGL NHGQAGKTMD PASVLPVFIA IMLVVSALLP GDKACALLGS LLPLALIASM  360
MGAAGSGANA NGGAAFDCLF RLMHSLSTLL SKSSRTLQRS LKRMLLARQR YLGAKGMAKL  420
GTAGARLFDQ LLTTPSPTSP SAAEDPGIAP GSPSDSDGRN NADMDVDVAT VLAAEPAEQA  480
PPTATCAAAV LGAKPTAEAP VVAMAGALQA GCGGVVVVKQ EPVC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1230243RQIEDPAERRRQRR
2237244ERRRQRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00117ampDAPTransfer from AT5G11260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre05.g238250.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002957643.11e-108hypothetical protein VOLCADRAFT_121646
TrEMBLD8UG371e-108D8UG37_VOLCA; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20811737
ChlorophytaeOGCP577378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.19e-10bZIP family protein