PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre03.g184600.t1.1
Common NameCHLREDRAFT_195865, RWP7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family Nin-like
Protein Properties Length: 989aa    MW: 99618.5 Da    PI: 6.9546
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre03.g184600.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK70.52.3e-22646695352
              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ++i+ e l++ ++l+i++AA+eLg+++T LK  CR +GI+RWP+Rk+ks+
  Cre03.g184600.t1.1 646 ASITKERLQQVYHLNIEEAARELGIGMTKLKEHCRTLGIPRWPSRKLKSM 695
                         789*********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.188627715IPR003035RWP-RK domain
PfamPF020427.5E-21647694IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 989 aa     Download sequence    Send to blast
MDTATAGPMM REDVQGALGA AFSAGMVGAH GSSALPLHLG AAHAATIAQL AASPLAFATI  60
AGPLAVADFA QANVELLRSR SSAEQRPEQP RPSALPTARL IEVARAALQT VRRGQGVPLG  120
AAPAAASEPT ASERQREVVG GSQGRPPLLK REAPESDSVD RDRLSEAKRT RIDAPDAQTR  180
FSLSASVPAA AASSADAVAH VSADSADTSV PAPVAELAES VPISTAAPAK LVSPFAAPPL  240
PQLPGQSSVS GCDADGATTR ATGAGSQAAP SLGGFKSAFA AAAAAELWEP GCSFTTGRRS  300
ARSSALKSNG TASLPRALAS EGQSLSRRGS GFVVAAAALA IGSDATAANA AAHSGLERPE  360
RGRSGTMGAW GSGGGSKPES AASADLRRLA QLAEAAALLE GFSAGHVRGN AADGADTGGK  420
ATTSPSRHRA GSLPTAGMVA ASGAAASATG SGGSGSGGCG GSSGRQQAPQ QHQQLAGNSS  480
GAGAAHGGGG ASLRSANSLP LRALESQPLP GSRSRSERAA RDGSPDSADG CNGSAGLSRG  540
RSGELDSWRG GARGSGAHDD GTDADEGMEG DDLLADEDED DSAGGDSSGR SLTDRYRAVL  600
KASAQQRGRG SGSAGRGGGG RAGSPDDEDV LGRSGSMRNG VCARIASITK ERLQQVYHLN  660
IEEAARELGI GMTKLKEHCR TLGIPRWPSR KLKSMDKLIE SLNERAAIEP ATKEVINDIL  720
AEIESFKRAI YENPCLEVEE DIKRLRQSNF KKEYQQRQVE QRLRVSEPRS ERERGGASSL  780
GRAASGSLAT SSQQQERPAT GSGAVASRGA RYGGNLESSP SLPLTEAGAC GMGVPVGVAA  840
LALAAQAAEM PAVNLARAAS LAAVAGLIQP VMPPSNVLDI SVQSAAALAP PPPPQLPGLL  900
PPQLHQLLLV QQHAALHSQG ITALLPAGVL PMPLQAADKP QERAGDTNHC DAPAAAEPLS  960
AADNLAERVS VAVDRVGSEA SPKVAVER*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.95960.0nutrient deficiency
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre03.g184600.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001691825.10.0RWP-RK transcription factor
TrEMBLA8IRH10.0A8IRH1_CHLRE; RWP-RK transcription factor
STRINGEDP043150.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.15e-21RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Merchant SS, et al.
    The Chlamydomonas genome reveals the evolution of key animal and plant functions.
    Science, 2007. 318(5848): p. 245-50
    [PMID:17932292]