PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre03.g153050.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family Nin-like
Protein Properties Length: 1238aa    MW: 123842 Da    PI: 7.2682
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre03.g153050.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK58.11.7e-1811061155352
              RWP-RK    3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52  
                            +++ed+++ F+l + +AA+ Lg ++T LKr+CR +G +RWP+Rk+ sl
  Cre03.g153050.t1.1 1106 RAVTFEDMQAVFHLRVVEAARALGFSATELKRRCRALGFSRWPQRKLLSL 1155
                          5799******************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.22310901175IPR003035RWP-RK domain
PfamPF020423.0E-1811081155IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1238 aa     Download sequence    Send to blast
MELGLLQDDV GSPAEADDIL RSLLADDISD APGLIFDNSL AEAGDHGHAT GAPVSAVPGA  60
ASVTGAFDGL LPNLWQLGTA VGPPAPQAQP LPEPLQQQAL LHPTQTQADE VQRRHADVMA  120
WLAASEGMGG IAVSPEVLSF PQAQPGIGLL MGGMQGASAA QYGGGMAGSG LGAGLPERRI  180
SNTSAGAMAA AGAVHPHPQQ LLVPAALSPT AAAVTHGGIA RVSAGSASLA PASVEPMLTS  240
HLTAAARPSL SFSGHAPQQL MQGMLLPPHQ MAAAAQQQQQ QQQQHVLLVQ QQAALQGQPS  300
TMSAGMAAGL MPPVMPQAVA AAVVGNSTSG GTGVPQQHMQ AGSAMGAAPG AQDDRLFAEI  360
EAMPFPRYPH RHHLQHAAMT FVAAYGKTSR GSGTAATLMS GPVPQAPVPV AAELEAAWRG  420
PNAEAPSCVA ASTRGAARRI TGSVWPAGGN ASGSTAGDVV PAALAAAAPE AGERQGPSRL  480
PGVGQGGTVP LVGGAPLAPG AAAPLAPSAA PNAQLLAMLG RPESQHQPQP PAQQPPQQPQ  540
PTARAPHAAA THGHALVQSD QYQMLQSLGS LVQSGNWLGG AGPQGWAVAT EPLLPWAQRD  600
DSFAAAAGGL LGNLGAGGGA AAVAGLSAPV LALSAPVTLR DLHSVCDNMT RGPGEGGVSR  660
FAAGGGEGDG GAGGEGLMSM TAASFDMMGD AAETCTNADT IMRTVSFSRH GGSKGSSSMT  720
TGSSMGSGDR TGERVSAAAY ARPPGPAAAH GEAALRSNEQ SAHQGPAAAA AAAAAAAAAA  780
AAAAAVSAAA AAAAAKVTAG ANATGAKRLA GQSSGVTGAS QDGARSLEPR QQSMPPGSER  840
LPSRTPSDTA RILQLGPEAT KEHSEGNKGE SEADKAAGRA EGQSAAPEPR VRGAAGRRRG  900
TGASRRDRRA PTHGAAGAEE EYGDDEAEGQ RASGTQQKPQ AQQKSETGDG VQSRDPELGA  960
QPEPELEREL LPVRWSLRSR TRPPASVMQK SAGSPDAAKP AKAKPKRAQA AKAQAKARKG  1020
KRQSTKEDSD AGDSSSSTSS RDNSNEPQSA KGSESGSGGG RNHRGGRSGA GAAAKESSGA  1080
GTESDAADGA TAGAAGGGGS AFRRARAVTF EDMQAVFHLR VVEAARALGF SATELKRRCR  1140
ALGFSRWPQR KLLSLQRMAD SAAADKRLAP DQKQAMLAAL ERNRVAIMAR PDTPLEDGIK  1200
VARQVQYKAL HNNRTKGGAA AGAADASGAG DEDDADE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre03.g153050.t1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001697479.10.0RWP-RK transcription factor
TrEMBLA0A2K3DVU20.0A0A2K3DVU2_CHLRE; Uncharacterized protein
STRINGEDP001410.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-15RWP-RK domain-containing protein