PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre03.g149350.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family Nin-like
Protein Properties Length: 1729aa    MW: 174688 Da    PI: 6.9539
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre03.g149350.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK62.19.5e-2015621610351
              RWP-RK    3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51  
                           ei+ + l+k ++lpi++AA  L++++TvLK+ CR++ ++RWP+Rk++s
  Cre03.g149350.t1.1 1562 REITKHALRKVYHLPINEAAAALNIGVTVLKKYCRKFRVPRWPYRKLQS 1610
                          689********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.47215471631IPR003035RWP-RK domain
PfamPF020426.4E-1915641610IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1729 aa     Download sequence    Send to blast
MDTGSAAIAA DAAVSKDSND SQVAAEIAHP GCGYQATQKC KDSGTGRPGE VDLGGDVKDT  60
QLVKAPADAA NSAMNTCGRL SGPKAPGGGG PPLPLKAMKE AGSGAGLDGE SRVHFLQEAF  120
LTISEELAAQ GVNPHAVIAA ASNSPTASRG ASSGGVAAAV AAAAFILPAV RPLSAPTTAA  180
IPVVMAGGGS GVVPAPLPTM PSLTPSQAQT QSCANAAADA ASPTAASGGG GPPASAPLLP  240
DGPAAPAAPA IGGGNGGGDA AAMGDAAAAA AAGGFDFLFD AFHAFVHHDG PTADANTVAA  300
EASPASKARP TSQQPTAVQT ADRDQSTCRA AGMQPPPPQS ALSGVATAAR ANGRSVTMFD  360
VWAAGEEGGS DGGNGAPATD TDPIQQPSAA PPTAEGDGTA QQQQADSHGG AAAGSTAVEA  420
IAGASSKTLA APKPVRLSPF SGGGGAVSAF AGPATTCISP APMDAMDGSD GDGIGRGDSE  480
GGKGFGGASR RASRRGGGAA GGATPMRLSN ALSLLGAASA GGGYMDLLGP GDMFMDSGVD  540
PLADILMDAM RPSLTEIPVV AMPAAAAAAA AAAGGAAAEP AGRSGVPRSS LATLNRMLMS  600
EGRQQPQPLQ SQLVQQMQQQ SAGVSSAPPG SGGLAAACAA GSNTDPRHCL PSPAAVVAAA  660
AVAAAQQQQH QLSSPPLTGG QPQHQQQLLH GSRVVQAQAG SYESIMGGGL SAVALMDLEA  720
MSRHQLSAPA ILTRLPSGSG CAAGVKQFYQ QQQQQQQQQQ QQQQQQQPHQ PHQQQMQQMQ  780
QQAVQQQQQQ HAAFAHQQQQ QPMPQQQQPH PQPQQTATSS LLQDVLSTAR AVLGNATTVG  840
SMFPAPAAGS HSNTAFANAH VNKAMLQSLP ASAGSGVPLF TAHQQQQLMQ HHQQLMATQH  900
ASSNSAGTTP TGGAAHGVPG SVPGGGSAAI MQPGPVVSAP SPWAPQALVQ LPPAAAPPAG  960
ATGLYQLQQT QQVQQSQHLQ QTHTVGGPPA LMQPQQQHLQ QQHLHPMSLS QPLPSHNAPM  1020
MPTSQAPPPH QLPLPQHQQH LLSQQQLQSG GIQRSISMGH YRMGPETVEL VDAQRLQKQA  1080
QQQQQQVRSL QQPSHAQQQQ QLHLHHFQQQ LPAPMMISPV GPPISTMIQN HQQQQTLRPP  1140
SVPPIFASDL AVGAAAHGGG APSISTSTGN SSSAAIHIKV AAHAMPTGPL FVGSYGPTQQ  1200
QQQQQQQNLM RALEEARRSA GQQQPAGSSG GHGGGAGDNG VPCRGFARTS SGSTAGGGSA  1260
HHHQQHQQQH QQQQPYQQQQ QPALADGCNS PPAGPASRNP SGRSLLIRHT SGLARTTSAA  1320
ATAAAGGASG ITSPRSPAAA AAAGGGPGTP RSRSFRQQQS QQQRSDVPPP SSLLGSGTFL  1380
AGDMGIKLED GSTAPVGYLG AAAAAVPTGA APTAALAAAL AAGVMRRGGG SDDGGAGAPA  1440
AASGDSGEGS GADADAAGGT VRRSRREPRG GVKTSRSGGA GGRRRRAGDD DDAPYETDDA  1500
EEEESSDGSD SDLDDDFLGG GGGGRRSRKL GRDGGDDDVD GGYYVDDNSV LVVRAVKDGQ  1560
RREITKHALR KVYHLPINEA AAALNIGVTV LKKYCRKFRV PRWPYRKLQS MGKLIESFQR  1620
YKKGALGAGN TDEAERCEAV IQSLYRFREE VYDNPDKDID ESVKKLRQAN FKIEYRQRQG  1680
QTQGAPSTAA AAADILIEDG IGMEGVAMEA GRGGAEGGSS STSEAVAA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre03.g149350.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3DVL00.0A0A2K3DVL0_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.11e-19RWP-RK domain-containing protein