PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre02.g083750.t2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family G2-like
Protein Properties Length: 1892aa    MW: 173326 Da    PI: 5.45
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre02.g083750.t2.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.11.5e-2614581511155
             G2-like    1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55  
                          kpr++W++eLH+rF++a+ qL G+++A+Pktil+lm+v+gLt+e+v+SHLQkYR+
  Cre02.g083750.t2.1 1458 KPRINWSQELHARFLNAMFQL-GIKNAVPKTILQLMNVEGLTRENVASHLQKYRI 1511
                          79*******************.********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.42314551514IPR017930Myb domain
SuperFamilySSF466894.48E-1714561515IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-2614561515IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-2214581511IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1892 aa     Download sequence    Send to blast
MPPRCQDFSA QLSGLADPGV KGPQAPASGQ ERRTHSSPQG PAAAAKAAAV APVGSEAAAG  60
SCGGGKGSGA PAAGAETGPS CPGGDQGSEG TAARAAAADG DPLAAPKAAQ QQQQQPRSPA  120
ITAGVPGAGT STASLPASRA ARVHGVAAGV ARPAAVVPTG SGITGTAADV RRPHPYHNHP  180
NHHGRDMTNG DNGNSAHGTN DGSGSGSGNG DSINNNSGGG VANAAAGGPA APAPASGAAG  240
GTNVPHSHHH HHSHHYHSHH HSTELAHEGS TSTGAPAPPG LAPLTRGNDR ASSAFTAYVR  300
RVPYAATGAD AVSAHGAEPA ANTPNASGGN GNENGSGSAH GSAHGSGHAS GHGSGSNGNG  360
AGAGTGSSGN GNSSSGGQPT TTTTTTTNGR HHSNGGGGNS NGNGSHGQGP TAASALVGSA  420
SSRRMGTPHQ RCDGGPREHN SLDRNDSGSN GNGNGNGSSS ERGPACGSSK HAGSHGHAAP  480
PPPPTAIGHA GAGPHLASQH QQHRTSHAQL PGGGRLAGST CSGGGGGVGA GCGVSNRLGE  540
FVAAAAAAAV GNAGSGGNSG SGSGSGSGSG SGSGSGSGSA SPCTLLKTEQ EEGAAAGPDI  600
GLDGGADADA ARAEGAADGT DIDMDDADGD GDGDGDGDGD GDGDGDGDGD ADADGDGDGD  660
GDGEADAEAD MDDGMIPYDA KPLELAMLAA GTTASGGADR GGGGGGGGFG GGAAGAPPAS  720
LSNQQAAAAM LELATGGGGS SSAGVGTGVG VGSSSGRLGS AGGLSGLLLA VGGGGSGGTG  780
GMMPVQLLQM LTSTPGGLAL LTPSQLSELV VLVASGGSGS GGSGGGPGPQ QGPAATAVLA  840
SPELQLQQLL QQQQQQHQQQ QLQLLLQLQQ VMNGGGPLGP GGLGPGAAAA LVGPGSLPGL  900
AGLGGLLGNP LASLGGLGGL TALSGLGSLA SGLAGGGLGG FAGGALGGGG VLGQALGLLG  960
PHPLTAAAAG GGAGGGAGGS SSGGVLASLL GGAGPTAGGG GLGGASSGSA TAALAAAVAA  1020
QQQQQQQQQQ QQQQQQLLML QQSSQKPSSS TGAPFPYAQQ QAAHTQTPSG GERNSPAILS  1080
APEPPASAQP APLLPMPQPS GGAGAAAAAA AGAPTAAGGG GGGGRRSSGS ADGSVPVRLA  1140
PTPGDLLHGS GLAHQSPTVA VETVIKAEPE ADAEAEEEAA AAANAAAAAA AAAAFNVFAD  1200
IADAQLDEAM GVEDGEETED GGAGPRQDDE GDEETGTDTD GRQDRRGGSG SPLDMVAAAA  1260
AAAAEAEAEA EAAAEARVAS RMTIITGDGG DTDKICQVSL LDAPPLVRLS AQHNGATAEA  1320
AAAAAAAATS SAGGAGGAAG VFMARRLGGA AAAMAVTAAV AAEVTAAAGS GSAGGGATAS  1380
GGGGSVIGVK RKASALGLAR TASGLLSGGA GGGGGGGAVS SPAAAGTAGA SSGEEPTGGG  1440
GSVAGGDGAD LSCKAPKKPR INWSQELHAR FLNAMFQLGI KNAVPKTILQ LMNVEGLTRE  1500
NVASHLQKYR ILLKRHANLP ANAPLNPDNL RKLEVVQQAV QQSMQQSLLP PGATNAGGAA  1560
GGLISVAVGG GLGGTLSYQD LINQLSAMSG HHSAVSAPPP ASAAAISGPP AVAAPRAVAV  1620
GPPGPSAPSP AVAAALQAAA GASAGPAAAV GAVPQAAALQ GLHRVAAAAA ASAGASASSA  1680
ASLLGITSGG GGGAPSATGT SGGSPAVSLP LATLPLPALA GGLNGLGGLT IGGGAGGGAG  1740
GLSAVIGGLA GGLAGPLAGL TGPNGLNGPL AAAAAGLGGL GGLPAGLSGA LAAAAVSGLP  1800
GGLGQAGGAL GGLGGLNLNV GALGGLNLGS ALGMVGPGVL ASALVAAGAA GGGGGSAGMT  1860
GATGSGGGAR EAPGGGGAAT PPPAAGGTPG A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-2314581514157Transcription factor LUX
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre02.g083750.t2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3639680.0AB363968.1 Chlamydomonas reinhardtii ROC75 mRNA for RHYTHM OF CHLOROPLAST 75, complete cds, variant 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3E0T30.0A0A2K3E0T3_CHLRE; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.13e-24G2-like family protein