PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre02.g083750.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family G2-like
Protein Properties Length: 1897aa    MW: 174167 Da    PI: 5.3968
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre02.g083750.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.11.5e-2614631516155
             G2-like    1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55  
                          kpr++W++eLH+rF++a+ qL G+++A+Pktil+lm+v+gLt+e+v+SHLQkYR+
  Cre02.g083750.t1.1 1463 KPRINWSQELHARFLNAMFQL-GIKNAVPKTILQLMNVEGLTRENVASHLQKYRI 1516
                          79*******************.********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.42314601519IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2614611520IPR009057Homeodomain-like
SuperFamilySSF466894.48E-1714611520IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-2214631516IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1897 aa     Download sequence    Send to blast
MRLQQPNLDP NTLGKSFDLD YSSWSAGLWA PASGQERRTH SSPQGPAAAA KAAAVAPVGS  60
EAAAGSCGGG KGSGAPAAGA ETGPSCPGGD QGSEGTAARA AAADGDPLAA PKAAQQQQQQ  120
PRSPAITAGV PGAGTSTASL PASRAARVHG VAAGVARPAA VVPTGSGITG TAADVRRPHP  180
YHNHPNHHGR DMTNGDNGNS AHGTNDGSGS GSGNGDSINN NSGGGVANAA AGGPAAPAPA  240
SGAAGGTNVP HSHHHHHSHH YHSHHHSTEL AHEGSTSTGA PAPPGLAPLT RGNDRASSAF  300
TAYVRRVPYA ATGADAVSAH GAEPAANTPN ASGGNGNENG SGSAHGSAHG SGHASGHGSG  360
SNGNGAGAGT GSSGNGNSSS GGQPTTTTTT TTNGRHHSNG GGGNSNGNGS HGQGPTAASA  420
LVGSASSRRM GTPHQRCDGG PREHNSLDRN DSGSNGNGNG NGSSSERGPA CGSSKHAGSH  480
GHAAPPPPPT AIGHAGAGPH LASQHQQHRT SHAQLPGGGR LAGSTCSGGG GGVGAGCGVS  540
NRLGEFVAAA AAAAVGNAGS GGNSGSGSGS GSGSGSGSGS GSGSASPCTL LKTEQEEGAA  600
AGPDIGLDGG ADADAARAEG AADGTDIDMD DADGDGDGDG DGDGDGDGDG DGDGDADADG  660
DGDGDGDGEA DAEADMDDGM IPYDAKPLEL AMLAAGTTAS GGADRGGGGG GGGFGGGAAG  720
APPASLSNQQ AAAAMLELAT GGGGSSSAGV GTGVGVGSSS GRLGSAGGLS GLLLAVGGGG  780
SGGTGGMMPV QLLQMLTSTP GGLALLTPSQ LSELVVLVAS GGSGSGGSGG GPGPQQGPAA  840
TAVLASPELQ LQQLLQQQQQ QHQQQQLQLL LQLQQVMNGG GPLGPGGLGP GAAAALVGPG  900
SLPGLAGLGG LLGNPLASLG GLGGLTALSG LGSLASGLAG GGLGGFAGGA LGGGGVLGQA  960
LGLLGPHPLT AAAAGGGAGG GAGGSSSGGV LASLLGGAGP TAGGGGLGGA SSGSATAALA  1020
AAVAAQQQQQ QQQQQQQQQQ QLLMLQQSSQ KPSSSTGAPF PYAQQQAAHT QTPSGGERNS  1080
PAILSAPEPP ASAQPAPLLP MPQPSGGAGA AAAAAAGAPT AAGGGGGGGR RSSGSADGSV  1140
PVRLAPTPGD LLHGSGLAHQ SPTVAVETVI KAEPEADAEA EEEAAAAANA AAAAAAAAAF  1200
NVFADIADAQ LDEAMGVEDG EETEDGGAGP RQDDEGDEET GTDTDGRQDR RGGSGSPLDM  1260
VAAAAAAAAE AEAEAEAAAE ARVASRMTII TGDGGDTDKI CQVSLLDAPP LVRLSAQHNG  1320
ATAEAAAAAA AAATSSAGGA GGAAGVFMAR RLGGAAAAMA VTAAVAAEVT AAAGSGSAGG  1380
GATASGGGGS VIGVKRKASA LGLARTASGL LSGGAGGGGG GGAVSSPAAA GTAGASSGEE  1440
PTGGGGSVAG GDGADLSCKA PKKPRINWSQ ELHARFLNAM FQLGIKNAVP KTILQLMNVE  1500
GLTRENVASH LQKYRILLKR HANLPANAPL NPDNLRKLEV VQQAVQQSMQ QSLLPPGATN  1560
AGGAAGGLIS VAVGGGLGGT LSYQDLINQL SAMSGHHSAV SAPPPASAAA ISGPPAVAAP  1620
RAVAVGPPGP SAPSPAVAAA LQAAAGASAG PAAAVGAVPQ AAALQGLHRV AAAAAASAGA  1680
SASSAASLLG ITSGGGGGAP SATGTSGGSP AVSLPLATLP LPALAGGLNG LGGLTIGGGA  1740
GGGAGGLSAV IGGLAGGLAG PLAGLTGPNG LNGPLAAAAA GLGGLGGLPA GLSGALAAAA  1800
VSGLPGGLGQ AGGALGGLGG LNLNVGALGG LNLGSALGMV GPGVLASALV AAGAAGGGGG  1860
SAGMTGATGS GGGAREAPGG GGAATPPPAA GGTPGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-2314631519157Transcription factor LUX
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre02.g083750.t1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3639690.0AB363969.1 Chlamydomonas reinhardtii ROC75 mRNA for RHYTHM OF CHLOROPLAST 75, complete cds, variant 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3E0Q50.0A0A2K3E0Q5_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.13e-24G2-like family protein