PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre02.g079200.t1.2
Common NameHAP3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family NF-YB
Protein Properties Length: 210aa    MW: 21897 Da    PI: 5.3882
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre02.g079200.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.51.3e-5516110296
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         reqdrflPian+srimkk+lP+naki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfe+y+eplk+yl+k+re
  Cre02.g079200.t1.2  16 REQDRFLPIANISRIMKKALPNNAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMTTLGFEEYLEPLKLYLAKFRE 106
                         89***************************************************************************************** PP

               NF-YB  93 lege 96 
                         +e++
  Cre02.g079200.t1.2 107 AEAA 110
                         9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.9E-5511145IPR009072Histone-fold
SuperFamilySSF471131.86E-4018128IPR009072Histone-fold
PfamPF008083.0E-282185IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.8E-214967No hitNo description
PROSITE patternPS0068505268IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.8E-216886No hitNo description
PRINTSPR006152.8E-2187105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MSGDEGDGRD GNSNAREQDR FLPIANISRI MKKALPNNAK IAKDAKETVQ ECVSEFISFI  60
TSEASDKCQR EKRKTINGDD LLWAMTTLGF EEYLEPLKLY LAKFREAEAA TSNKPGGGSG  120
ANAEAKREAA AAAAAAAAAA AAVSQQQAAQ QQMAAQLQAG MAFPGLMPAQ FQGLPPGMIP  180
AGFPGLPLPP GVPGLMMPGG VVPKQEPPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-4816106393NF-YB
4awl_B5e-4816106494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-4816106494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.32060.0normal conditions
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre02.g079200.t1.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002949581.17e-80hypothetical protein VOLCADRAFT_117284
SwissprotO233109e-62NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0I9QPW61e-148A0A0I9QPW6_CHLRE; CCAAT-box binding factor HAP3-like protein
STRINGXP_002949581.13e-79(Volvox carteri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP20231616
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.19e-63nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Xie Z, et al.
    Duplication and functional diversification of HAP3 genes leading to the origin of the seed-developmental regulatory gene, LEAFY COTYLEDON1 (LEC1), in nonseed plant genomes.
    Mol. Biol. Evol., 2008. 25(8): p. 1581-92
    [PMID:18453547]
  2. Han X, et al.
    Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis.
    J. Exp. Bot., 2013. 64(14): p. 4589-601
    [PMID:24006421]
  3. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  4. Hossain MA, et al.
    Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
    Front Plant Sci, 2016. 7: p. 650
    [PMID:27242851]
  5. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]