PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre01.g051174.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family bZIP
Protein Properties Length: 2019aa    MW: 198081 Da    PI: 6.4419
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre01.g051174.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.71.2e-089871036453
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1    4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53  
                          +k   r+++NR+AA+++R++K + i++ +   + + + N++L+ +l +l+
  Cre01.g051174.t1.1  987 DKTVLRRERNRLAAKKCRAKKMEFIAQMQAQLDDMAQRNEELATQLATLQ 1036
                          78889**************************************9998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-49841045IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.1289861037IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.31E-99861037No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-119881037No hitNo description
PfamPF077162.7E-69901037IPR004827Basic-leucine zipper domain
CDDcd148091.03E-129911040No hitNo description
PROSITE patternPS0003609921006IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2019 aa     Download sequence    Send to blast
MDLANAPSLG FFLAAAASGG SGGGLNGIGS GDGGGGGGGS SNGGGFADRL DTSRLASLDT  60
LAAAALAVEV EDEFGLGLAL GLGPPAGEAG GTGGGGLARP RSGLLLRARS VPLPHQQHQH  120
LQYVHAPSQC HAAAADCGGE ASAQAQPQPQ LDQQQRVRQL SRAAATPFAL GAPPPASPPA  180
ALDSAGGGGS GGAGAGAGLG GGDIGVPAAH TLSPPASPLH PAPAGPVVAP MRLQPATPPA  240
AGRGTAPAAT PFATAAAAAT GSASMPAAGT PGDLGDSQEQ GQQVEKAALP GSGNDATTSA  300
VSGGTCDGGT CDGGMPAPQT PSAAAKRDSK GGGGDGSLSG GGGSNGSRQL PHASQPRISA  360
PSAAGGGKNT TAAPASAPAS ADASASLLAG ANTASTPAQL PPLPPLPQPS RSSAKAPVVR  420
PGRPAGSPPP NTARGPLRQQ HLPDLSSLRP GGPSTSSRAS GSAGAAGTST ATKAKKGGQA  480
PARSKTPPRG RSDGAAAGAQ SEGTGGGGEA DSRQQKGAAD GGPRCRLPKR AAAVAAARRL  540
ADRSSGGGSQ AAEQEVVGGE VEEVGGEGVE EGQEEAEPVG SEEEDEEVNS SESHDGPGAE  600
AEPGAANGTL TAITAHMSPS PFRPAAPTTA RAPLAAPAAP AAPATTTAAD VVAGDAAALI  660
CWASPEPPPP LHQQQQPLLL PGPASSHAGD TAGAPGTVPS QLTRCTPGLS HAHISSASPE  720
AAPLPLQPHL PYPQPQPPAL GPPLQLQPPP SPHAPPHQLQ SPPKPEQLLS QPPRPPQPVG  780
GADLSPYLDV PSDIRCPEEL DLLPPLPPLP RLKLQPPGSK LQPSGSQPEQ QQRPGDALPL  840
GSATSSGAVK SSGVAKPPSP TLAGTKRQAP APAVPLASGA PAGGSRTAAA AAAGGDEQEP  900
QPPPAKKSKK KKKKGGGAGA ASGGGAAGAE GGAGGSPPRS LPPVSSLLGL PTPASAAAAA  960
AVAAAAAAAE VAAAACAGTP RPIKTNDKTV LRRERNRLAA KKCRAKKMEF IAQMQAQLDD  1020
MAQRNEELAT QLATLQRLHV RELHCKEVLK MVLQGCWDLP GGAASRLPYS ADAVLASLEA  1080
GTMDVGPLLD ALSGAAEPPP LRQPEQLQGQ GQHQQHQQTP RHLQQPQQAQ QPQKAQQLQY  1140
PQQQQQALMA PPGAPPASPH APSLDPGASP QQQGLLLPAP LHLPHGAPVL LPPSAASAGG  1200
AASAEVAAAA KAAVAAGVHL PQAGSVTDAT ASAGGAAATT PAFLPVAGGS GAFDTLQRQQ  1260
QPPQRQQQPQ AAAVEEEDED EDAADDRAAA EAEERRLPEP QPPAHMVGSG GGGGGGGNTF  1320
TALLRGGSLG FAASLQAASR AGFGGSATGY GAAGNGASGS AAAGSGGGGG SLTASGRLGS  1380
LDWLLLAAAS MDAGTANAIG AAVGGDPAGS TGGGAGENAG NDNSAGGQLP PPRPLDIPQL  1440
HGGSGGDGGV GSAAVAAAPD DGNATGYYVG DGGGGGGGPL SAFANLPYQP PHQQQQQQPQ  1500
AAPHAAALPQ QSAYWGQQPY GPLMPYPTEA APGSSAAGAP AALGTGLLPQ GHQEHGQGQG  1560
HQSPLQLQVP RHPPGHPGLH CLTQQPQPQL PGHGSSAGSE QQQQITIGSS EELEADGGEG  1620
GGPDQQAVVA AATAAAPAAA AAALALYYVG GGGGGGVAGG GGGGAGVALQ QEYSVGGPGS  1680
AYYAQAQQPL LLLQAQAHQQ QQLQVPPPLF AAGVGVPTAA TVAAADGNTG WQWDGTPITA  1740
PSAAGATGSM LPPGLQYQPQ SPTQQYQAVR SPIPQQLPYY QSPQASQLQP QPMQSPPHQQ  1800
QQPQRQPQPH RQPQPQRQAM RTPFSDFWGM GAALAAVGPS AAGRQQQEDP PSSAGAAAMP  1860
QHQDFQVRVG PSSEWGRSIA EVGALRTMHQ QQLQHQLHQQ HPYQWQQAAP GAELQPEVGS  1920
GSGSGLATTA SAAVEAGEGC GVASTGGIGF RSATAAVAEA MAAPSLLHDA TSVVSTLGAT  1980
AAPQAQVHLP SPPAKQARQR EAQQPAGQLS DTPKRRRR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12939SGDGGGGGGGS
2905913KKSKKKKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre01.g051174.t1.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1129822