PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre01.g000050.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family Nin-like
Protein Properties Length: 1605aa    MW: 160942 Da    PI: 8.2195
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre01.g000050.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK40.74.6e-1314571504350
              RWP-RK    3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50  
                          ++++++dl+   +lp+ +AA++Lg+  T    +CRq+GI+RWP  +++
  Cre01.g000050.t1.1 1457 NRLQVSDLRPVLHLPLVEAARQLGLHRTSFMTRCRQLGIARWPAKQLR 1504
                          57999**************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.43714381527IPR003035RWP-RK domain
PfamPF020424.1E-1314591504IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 1605 aa     Download sequence    Send to blast
MSKVSRILHR KRDTARAERA RDVLAAKRAA SKRERRQLRR AKASRRKKKG GAEAAAGPAD  60
PPRNTDAESP SVRPSPALPV HAGEPSGRPA AREGSRNTAL GHCVDSAPAH PYRQPAPICG  120
KRKQRSTPLA RALRLVQAGA PGLQTGVDLV AGVRGAKEAQ QARRPAPPVA KVRLLSLPLE  180
PKVDGQVGGC SPGQDTQPAP SSQEGGPAVI VRPDVAVLGQ DRGLGVAEAA GTSAAAAAAA  240
VSQRDRGAGR QPGQEPAESR DTSLSSELQP QPQMQTQRHE QGQQGLHESP PCESEAAVCA  300
REAAVAAARL AAINAAAALP PDSPYVRAVM ETCSGQATGG QAGQNQLSAH GLLQPQHEQQ  360
QRRRRRGLGA VDSEYVACAK HAAAAAAHLA ALEAAAALPA DSPYLKAAVE VGRGAGFGWP  420
DERDSDVWAQ QRALLQQQTA RLQRALGAAL CGRGGAARYT PAGPVPEGHG AGACSSGAAA  480
SLEFRVGSSP GHAEAASGAR GAVLAAEAAT AEAEAAGGIL VPAVVAGGGP AGSGRGGGTD  540
EVRAHHGSAV TTITPGCSVC SRMQASRNGV QAADAPAGTG VGGAAEAPED AAAVPGAAGQ  600
GARVSEWVGS LLLQSPQAES APPVFQKSKP GAEASGPAAE GRDPSPQVPA AIGCGASSTT  660
HGSGTTSSGN GATTGSSNSG DDSGGSTSSG GSLTGAADSS HSGGSGGDRV RSLSGARRSL  720
HGITDSSRST SSGGSDQSTS KDVNDAVTSS GGGGLGAGGC GGGAGIVAGD EPSTAVPESL  780
HRPASERSPG RCELTAAAGG GAEAGSAEAG GRAVVPARES QSWAQQLLPE HLPQWEDEVP  840
SDGSSCSDTD SSEFEEGDWE DDDWPGGAAE AKDGSRDKSQ HSADKPGASD VTDHMMAAVL  900
SQAAPEHSAG VKRAGGEAAI LYADGSDSHG GPDAFVDNDS AAWEAALEAG AGPHESQAEA  960
PQQLAAAVTV STLALLGHGT GPVQQSRRRL PASGSGPAGH DTAGLGAGAV ALAEPQLQLP  1020
EQFDVNLLAP PVLVPAGTKL QALPPWSVGS PVTSPGLTQA GPGPSAAAGP RVAQVVSGSP  1080
YTDAYELPDD GGHPHLGGGA APQPSSREDG GGVAAGVGAH AGCNAQRGMT AAVIGPGGTR  1140
VGAASPPLVL SASGSGGGLA TPGRRRGRLV MLHGAGAAAC GTPTSQPRAG RAASNTATAG  1200
GAGPSAVAAA GPGMGDLGHQ GQPLPAEPPG AATRPVGRAG RAPPLSPLRR SSRVPGGQQQ  1260
QQQQQQQQQH AAGMAAQGQG PAEPSANGGA GRSRASAGGG MSPSRRAAVR LQRQPVVPSP  1320
RLVEDSRLHR SGQQQAVVGV GTAGGSRVGD RARGGSGAGL SAAATGVIKA ATASPSRGRT  1380
RSKPPERASI AGRGRGGRGR RATARSHRQS ESDQEETADA VRPSDPEEDK EKEGGGQQTR  1440
GAPARRRAPR TPSEVLNRLQ VSDLRPVLHL PLVEAARQLG LHRTSFMTRC RQLGIARWPA  1500
KQLRMLDLME EQLQELEACG VANHYTAKKC LEEAPGWLAQ VAAARSALLE NPCGFTMPQP  1560
LELLRQRHVK VAWAHRQKYK AALGEEGEEG EEGDDLDSQA QMSQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre01.g000050.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3E4M10.0A0A2K3E4M1_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650