PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_941.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 228aa    MW: 25176 Da    PI: 7.8278
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_941.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.43.9e-18149183135
                         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                  C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  evm.model.supercontig_941.1 149 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 183
                                  *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.5E-732227IPR016679Transcription factor, GATA, plant
SMARTSM004012.2E-16143193IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.107.6E-14147181IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.385147179IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.47E-14147206No hitNo description
CDDcd002028.13E-14148195No hitNo description
PROSITE patternPS003440149174IPR000679Zinc finger, GATA-type
PfamPF003205.7E-16149183IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MDMYGLSSPD LFRIDDLLDF SNDDLFSVSS TAGANSSLET ITTTTSNSLP PQNPTAPFIT  60
FPSLSTDSAY DLCVPTDDVA ELEWLSRFVD DSFSDFPSNS VVGSDTSLFP GRARSKRSRA  120
TSWTLSPEAK GNKERSHRQS SPEGGVRRCT HCASEKTPQW RTGPLGPKTL CNACGVRYKS  180
GRLVPEYRPA ASPTFVLTQH SNSHRKVLEL RRQKEVLRQQ EQKHQVC*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_941.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021898436.11e-168GATA transcription factor 2-like
SwissprotO497412e-80GATA2_ARATH; GATA transcription factor 2
TrEMBLA0A067K9623e-92A0A067K962_JATCU; GATA transcription factor
STRINGevm.model.supercontig_941.11e-167(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32032666
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.11e-76GATA transcription factor 2
Publications ? help Back to Top
  1. Jiang K,Yung V,Chiba T,Feldman LJ
    Longitudinal patterning in roots: a GATA2-auxin interaction underlies and maintains the root transition domain.
    Planta, 2018. 247(4): p. 831-843
    [PMID:29249045]