PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_9.72
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRAS
Protein Properties Length: 587aa    MW: 66001.4 Da    PI: 4.9569
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_9.72genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS293.17.2e-902165844374
                        GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl... 83 
                                  Ll+ Ae v  ++  +a+++L++   l+s +g+p+qR++ yf eAL++++ r++ +  ++   ++ ++ + +e++++ +    
  evm.model.supercontig_9.72 216 FLLASAEKVGCQEYDRAKRFLNQCDSLSSDTGTPVQRIVYYFSEALKEKIDRETGRFKSKGL-ERVQKVDIDEAIMSPNPatl 297
                                 58999***********************************************5544444333.33333456666665533344 PP

                        GRAS  84 .fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetger 164
                                   +++ P+ ++++++  qaI + +++++rvHiiD++i+ G+QW+ L+qaLasR+egp   l+iT++g    +sk+ +e tg+r
  evm.model.supercontig_9.72 298 aCHQTMPFAQITQFAGIQAIIDNMAEASRVHIIDLGIMSGIQWAILMQALASRQEGPIeLLKITAIGT---TSKHLIEDTGRR 377
                                 599***************************************************8876599*******...6899******** PP

                        GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqead 247
                                 L++fAe++++pf+f++++++++ dl+ + ++++  E++aV +++ l ++      ++++ ++++++++++sP ++vv+e ea+
  evm.model.supercontig_9.72 378 LRSFAESMNLPFSFKIVMVSDILDLKENLFETDATEMVAVFSQFLLRSMIV----VPDRLEALMRIIRKISPYIMVVIEVEAN 456
                                 ********************************************9999984....4455566********************* PP

                        GRAS 248 hnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330
                                 +ns+ F+ rf+eal +ysa fd+lea + r++ +r++ E +++g+ i+n++a+eg+er+ r+ +   Wr+ + ++G+ ++ ls
  evm.model.supercontig_9.72 457 LNSPFFVSRFIEALFFYSAYFDCLEACMKRDNVNRVVTESRYFGEGIRNILAAEGNERKIRNVNIDVWRAFFARFGMLEADLS 539
                                 *********************************************************************************** PP

                        GRAS 331 ekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                  +   qakll +k++ +   +++ + ++l+ gWk+ pL+svSaW+
  evm.model.supercontig_9.72 540 MSSHYQAKLLTEKFNcGSSCTLDMNGKCLIVGWKGTPLLSVSAWK 584
                                 ***************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.924187563IPR005202Transcription factor GRAS
PfamPF035142.5E-87216584IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MANVMCFMEG FNSGAVEDKF SSSSQGFESL EYGTEACKRS RDIYSLGSDY GFHPDESSLD  60
NGFIVTKYDQ EQQQQLSCSD FRLLDGVSFN VASPPIQAYF EEMVKLAGGI QDVIEPKKEK  120
HVQFSFPALE LLNNYRSGFK RLNGEGRIIE PRNDTANTEG ATKKFSTEEI FRFAGEIFIQ  180
SSSQIVDGLS MVSHPFNLSF SGLSNEEIKD VELAGFLLAS AEKVGCQEYD RAKRFLNQCD  240
SLSSDTGTPV QRIVYYFSEA LKEKIDRETG RFKSKGLERV QKVDIDEAIM SPNPATLACH  300
QTMPFAQITQ FAGIQAIIDN MAEASRVHII DLGIMSGIQW AILMQALASR QEGPIELLKI  360
TAIGTTSKHL IEDTGRRLRS FAESMNLPFS FKIVMVSDIL DLKENLFETD ATEMVAVFSQ  420
FLLRSMIVVP DRLEALMRII RKISPYIMVV IEVEANLNSP FFVSRFIEAL FFYSAYFDCL  480
EACMKRDNVN RVVTESRYFG EGIRNILAAE GNERKIRNVN IDVWRAFFAR FGMLEADLSM  540
SSHYQAKLLT EKFNCGSSCT LDMNGKCLIV GWKGTPLLSV SAWKFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-452185848375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488851.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLV4RFL40.0V4RFL4_9R
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
MalvidsOGEM157861014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.15e-57RGA-like 2