PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_865.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 309aa    MW: 33732.2 Da    PI: 6.2338
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_865.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.37.8e-17207241135
                         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                  C +C + +Tp+WR gp g+ktLCnaCG++y++ +l
  evm.model.supercontig_865.1 207 CLHCAAESTPQWRTGPMGPKTLCNACGVRYKSGRL 241
                                  99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.2E-7219290IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.11201237IPR000679Zinc finger, GATA-type
SMARTSM004011.6E-15201251IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.47E-14204265No hitNo description
Gene3DG3DSA:3.30.50.107.5E-14205239IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.97E-12206253No hitNo description
PROSITE patternPS003440207232IPR000679Zinc finger, GATA-type
PfamPF003201.6E-14207241IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MEAPGFLAGG YYGAATRGFS SENRVPDQKN CENFTIDDLL DFSNDMILTD GFFDNVTGNS  60
TVTSTVSAVD ISDSSFSVTA DDHSSSFGHR SVGDDSHFSA ALVCVPDDEM AELEWFSNFI  120
EDSFSTEQNL NNLHILSGSK PPTPDSSSSS FNCTSFSPET PLPGKTRSKR SRVAPCDWST  180
RLLILHSKTT PIKNRERPNP DTPARKCLHC AAESTPQWRT GPMGPKTLCN ACGVRYKSGR  240
LVPEYRPAAS PTFVSTKHSN SHRRVMELRR QKELQAAQQQ FVGQSSIFGV SNGGDEFLIN  300
HRGGPEFS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_865.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021899635.10.0GATA transcription factor 4-like
TrEMBLA0A1Q3CBT21e-128A0A1Q3CBT2_CEPFO; GATA transcription factor
STRINGevm.model.supercontig_865.10.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56822749
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.11e-60GATA transcription factor 9