PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_85.56
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 326aa    MW: 35940.3 Da    PI: 8.4876
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_85.56genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.67.9e-17177231256
                                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                  rk+ +++k+q   Lee F+++++++ +++  LA++l+L  rqV vWFqNrRa+ k
  evm.model.supercontig_85.56 177 RKKLRLSKQQSAFLEESFKEHNTLNPKQKLALARQLSLRPRQVEVWFQNRRARTK 231
                                  778899***********************************************98 PP

2HD-ZIP_I/II125.91.8e-40177267192
                  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLek 82 
                                  +kk+rlsk+q+++LEesF+e+++L+p++K +lar+L l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+k
  evm.model.supercontig_85.56 177 RKKLRLSKQQSAFLEESFKEHNTLNPKQKLALARQLSLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQK 258
                                  69******************************************************************************** PP

                  HD-ZIP_I/II  83 eveeLreelk 92 
                                  e +eLr +lk
  evm.model.supercontig_85.56 259 ELQELR-ALK 267
                                  *****9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046186.3E-672141IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.608.0E-17161227IPR009057Homeodomain-like
SuperFamilySSF466898.13E-18167234IPR009057Homeodomain-like
PROSITE profilePS5007116.957173233IPR001356Homeobox domain
SMARTSM003892.1E-14175237IPR001356Homeobox domain
CDDcd000865.37E-14177234No hitNo description
PfamPF000462.4E-14177231IPR001356Homeobox domain
PROSITE patternPS000270208231IPR017970Homeobox, conserved site
CDDcd146860.00996226265No hitNo description
SMARTSM003404.5E-26233276IPR003106Leucine zipper, homeobox-associated
PfamPF021836.5E-11233267IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MELALSLGDT SRPPFPFLDK TNKISAGGDL GFCMGLGTGF SPGRSQENGE AEKTGRNGDD  60
CRRSRFPADP PLQLDLLPFS PLPRSQQPPS QLRLPWLTHN LRSEPDGAGH GLDVNRVPAA  120
TEETEEGITL SSSPNSTVSS FQMEFGIGGR SKRETAEIEP ERASSRASDD DENGSTRKKL  180
RLSKQQSAFL EESFKEHNTL NPKQKLALAR QLSLRPRQVE VWFQNRRART KLKQTEVDCE  240
YLKRCCETLT EENRRLQKEL QELRALKTSQ PFYMQLPATT LTMCPSCERV SPTLPSSGAG  300
SGSSSANPQY PFPLKPHKGP QPAAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175181TRKKLRL
2225233RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_85.56
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021894059.10.0homeobox-leucine zipper protein HOX11
SwissprotP466651e-97HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2N9HGR91e-148A0A2N9HGR9_FAGSY; Uncharacterized protein
STRINGevm.model.supercontig_85.560.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49282852
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.16e-83homeobox from Arabidopsis thaliana