PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_80.88
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family SBP
Protein Properties Length: 188aa    MW: 20878.5 Da    PI: 9.207
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_80.88genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP138.32.2e-4370146278
                                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                  Cqve+C a+l+eak+yhrrhkvCe+h+kapvvlv+gl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++a
  evm.model.supercontig_80.88  70 CQVEKCGANLAEAKRYHRRHKVCEIHAKAPVVLVAGLRQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSAA 146
                                  **************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-3563131IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.83867144IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-3968148IPR004333Transcription factor, SBP-box
PfamPF031104.0E-3370143IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MEARGLEGKL YSKEKAIKDC LVMEVDNDME DEEEIGSMGD GFGGDDEKKK KVSGKKGSGS  60
TSGSVSPPSC QVEKCGANLA EAKRYHRRHK VCEIHAKAPV VLVAGLRQRF CQQCSRFHEL  120
SEFDEAKRSC RRRLAGHNER RRKSAAETCS EGSSRKGVSP QCRQTDERDR IQINLPGTSS  180
FKRSQIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3961143284squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006370233.12e-73hypothetical protein POPTR_0001s40870g
SwissprotQ9S7583e-55SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLU5GXE92e-73U5GXE9_POPTR; Uncharacterized protein
STRINGPOPTR_0001s40870.15e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.11e-53squamosa promoter binding protein-like 5