PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_8.255
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRAS
Protein Properties Length: 455aa    MW: 50467.4 Da    PI: 5.2791
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_8.255genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS292.41.2e-89464452373
                         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                  ++lLl+cA a++++d +laq++++ l++ as +gdp+qRla+ f++AL +r ar ++++++a + ++ s++ + + +++++l
  evm.model.supercontig_8.255  46 EKLLLHCASALETNDVTLAQQVMWVLNNVASFTGDPNQRLASWFLRALISRAARVCPTTMSATTFNDGSSSIQRRLMTVTEL 127
                                  689*********************************************************9999999887666666677777 PP

                         GRAS  84 ..fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTg..vgspesg...skeel 158
                                    ++++ P+++f++ +aN+aI +a++g  +vHi+Df+is+++QWp+L++aLa+++egpps+RiT+  + +p  +    + + 
  evm.model.supercontig_8.255 128 agYVDLLPWHRFGFCAANSAIFNAIQGYPKVHILDFSISYCMQWPTLIDALAKKAEGPPSVRITVpfCRPP--VpplLNVSS 207
                                  99**************************************************************9444444..34589999* PP

                         GRAS 159 eetgerLakfAeelgvpfefnvl.....................vakrledleleeLrvkpgEalaVnlvlqlhrlldesv. 218
                                  ee+  rL++fA+  +vpfef++l                      ++ ++ l++++L+++ +Eal++n++  l +l de+  
  evm.model.supercontig_8.255 208 EEVCLRLKNFAKFRDVPFEFHILfadspilspspschdhpasfsFESLMTHLTPSSLNLRDDEALVINCQNWLRYLSDEQNg 289
                                  ***********************************999988776666788889************************98752 PP

                         GRAS 219 ...sleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                                     + +s rd++L+l+k+l+P v vvv++++d+ s+s+ +r++ +++y +  fd+le+ lp++s++r+ +E   +g +i+n+
  evm.model.supercontig_8.255 290 gfqDHASLRDAFLNLIKDLNPCVAVVVDEDCDLISSSLSTRITTCFNYLWIPFDALETFLPKDSSQRMEYESD-IGHKIENI 370
                                  222455599****************************************************************.******** PP

                         GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                  ++ eg++r+er e+  k ++r+++aGF +vp+ e+++k++k ll +++  g+ ++  +++l+l+Wk+++ v+++aW
  evm.model.supercontig_8.255 371 ISFEGSQRIERLESGTKLSQRMKTAGFFSVPFCEETVKEVKDLLDEHA-SGWGMKRGDDTLMLTWKGHNSVFATAW 445
                                  ************************************************.8899*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.91119427IPR005202Transcription factor GRAS
PfamPF035144.1E-8746445IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MKTELRGNAR TSSLSPQGSL FNSPAQTSLS GALRGCLGSL DGACIEKLLL HCASALETND  60
VTLAQQVMWV LNNVASFTGD PNQRLASWFL RALISRAARV CPTTMSATTF NDGSSSIQRR  120
LMTVTELAGY VDLLPWHRFG FCAANSAIFN AIQGYPKVHI LDFSISYCMQ WPTLIDALAK  180
KAEGPPSVRI TVPFCRPPVP PLLNVSSEEV CLRLKNFAKF RDVPFEFHIL FADSPILSPS  240
PSCHDHPASF SFESLMTHLT PSSLNLRDDE ALVINCQNWL RYLSDEQNGG FQDHASLRDA  300
FLNLIKDLNP CVAVVVDEDC DLISSSLSTR ITTCFNYLWI PFDALETFLP KDSSQRMEYE  360
SDIGHKIENI ISFEGSQRIE RLESGTKLSQ RMKTAGFFSV PFCEETVKEV KDLLDEHASG  420
WGMKRGDDTL MLTWKGHNSV FATAWAPTLS ELDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B5e-563944827421Protein SHORT-ROOT
5b3h_E5e-563944827421Protein SHORT-ROOT
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_8.255
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021907362.10.0scarecrow-like protein 32
TrEMBLA0A2C9UPS00.0A0A2C9UPS0_MANES; Uncharacterized protein
STRINGevm.model.supercontig_8.2550.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17642910
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-116GRAS family protein