PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_8.249
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 217aa    MW: 23945.5 Da    PI: 8.4484
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_8.249genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.51.3e-21957149
                                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                                 k+ien s r+ t+skRr+g++ KA+ELSvLCd++v +++fs++g+l  +
  evm.model.supercontig_8.249  9 KQIENPSSRYATYSKRREGLINKASELSVLCDTDVGLLMFSPNGRLTNF 57
                                 68********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.306161IPR002100Transcription factor, MADS-box
SMARTSM004329.2E-27160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-24387IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-20323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-211157IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MVRKKLEMKQ IENPSSRYAT YSKRREGLIN KASELSVLCD TDVGLLMFSP NGRLTNFGTG  60
PNGRFENVLL RYLDSSEDSR RCYEVNPEKI NTILEADVYQ NFLMTSLRQV QQMKAEMLST  120
ESSSSKSKRN RLNLEPIEDE NEADDNLGPH LTLHYLLKKA NDGKFQIGVD KSNSNNINDN  180
VVGDGDGNGN GKRNRSANNN RSGSASGSCN SNGGGK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_8.249
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021907292.19e-94asparagine-rich protein-like
STRINGevm.model.supercontig_8.2491e-156(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16598611
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.11e-21AGAMOUS-like 66