PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_8.239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family CO-like
Protein Properties Length: 438aa    MW: 48077.8 Da    PI: 6.334
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_8.239genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.97.3e-075189438
                     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedCllee..Hkg..Ht 38
                                   C+ ++++ +   C d+++ +C++C l++   ++  H+
  evm.model.supercontig_8.239 51 LLCDMCNSQSAVARCLDDKMSVCQSCDLNGngCSSlgHS 89
                                 57*************************998665446665 PP

2CCT62.71.2e-21381424144
                          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                  R++a++RY+eK+ktR F K+irY+sRKa+A++R+RvKGrFvk+ 
  evm.model.supercontig_8.239 381 RDKAKMRYNEKKKTRTFGKQIRYASRKARADTRKRVKGRFVKAG 424
                                  899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.3E-6552IPR000315B-box-type zinc finger
CDDcd000214.31E-4852No hitNo description
PROSITE profilePS5101714.684381423IPR010402CCT domain
PfamPF062031.3E-16381423IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MKEACMEPLC DFCGVVRAVV YCRSDLARLC LHCDSCVHSA NSLSRKHPRS LLCDMCNSQS  60
AVARCLDDKM SVCQSCDLNG NGCSSLGHSL QALDSYSGCP SLAEFSRIWA SVLYSSSSSS  120
SGFDNNGWGS LTYFPVNDNC MSSCLEQRDH NEGSFGLVAA KMSEFESCTN IDSWLDSSSM  180
IPLDPRYVPN FRNQPAFLPE ELHVTKDYSK FRDLKLHDGD ALCQSLNMGD VQLNFKAGDE  240
IFGCQQGHKR YQIEDLETDC LLNGKNLSVT ESNGHIESAL EASSSGQQDC AAFQSSRVGR  300
SANVMQAMNS SGCMVMNPCS NRSINLGFPA GQVHSGISIS VSNITGESSA ADYQDCGLSP  360
VFLNSESPWE SNLEVSCPQA RDKAKMRYNE KKKTRTFGKQ IRYASRKARA DTRKRVKGRF  420
VKAGEAYDYD PLVTRDF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_8.239
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021907151.10.0zinc finger protein CONSTANS-LIKE 12 isoform X1
TrEMBLA0A1R3GQ470.0A0A1R3GQ47_COCAP; Zinc finger, B-box
STRINGevm.model.supercontig_8.2390.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53192240
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.11e-107B-box type zinc finger protein with CCT domain