PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_78.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GATA
Protein Properties Length: 346aa    MW: 38228.6 Da    PI: 6.6391
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_78.7genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.7e-18236270135
                        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                 C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  evm.model.supercontig_78.7 236 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 270
                                 99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.6E-815326IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.36230266IPR000679Zinc finger, GATA-type
SMARTSM004012.0E-17230280IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-16232294No hitNo description
Gene3DG3DSA:3.30.50.102.6E-14233268IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.55E-14235282No hitNo description
PROSITE patternPS003440236261IPR000679Zinc finger, GATA-type
PfamPF003201.3E-15236270IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MEAPEFLQPS YCSQPNGADH FIVEDLLDFA NIDAAFDSLP GSSTDSTVTL VDSCNSSSFS  60
GSEPNFSADI AGHRNFTDAN LSADLCVPYD DVAELEWLSN FVEESFSSYD LQKLQLTCGM  120
KTRPEESSET QPNRTITTTS NAFINHNNNP MFHPDVSVPA KARSKRSRAA PCNWASRLMV  180
LSPTTSYSSE PEIVVQPPPP PPTQPTTGKK TVKGAAPRKK ETGDADAGGN ADGRRCLHCA  240
TDKTPQWRTG PMGPKTLCNA CGVRYKSGRL VPEYRPAASP TFVLTKHSNS HRKVMELRRQ  300
KELLRAQQQQ QQQFMHHHQN MMFDVSNGDD YLIHQHIGPD FRQLI*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_78.7
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021894930.10.0GATA transcription factor 12
SwissprotP697811e-101GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A1Q3BBZ11e-168A0A1Q3BBZ1_CEPFO; GATA transcription factor
STRINGevm.model.supercontig_78.70.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66252644
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.15e-81GATA transcription factor 12
Publications ? help Back to Top
  1. Ravindran P,Verma V,Stamm P,Kumar PP
    A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor.
    Mol Plant, 2017. 10(10): p. 1307-1320
    [PMID:28917589]