PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_77.48
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family BES1
Protein Properties Length: 407aa    MW: 44185.7 Da    PI: 8.6073
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_77.48genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822214.13.3e-6621451150
                       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaa 82 
                                  ++++r ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e+++++
  evm.model.supercontig_77.48   2 TSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKGCKPVERMDIV 83 
                                  5899****************************************************************************** PP

                       DUF822  83 gssasaspesslqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsssl 150
                                    sa+asp+ss++        +sp++sy++sp+sssfpsp+s++ + + +   +sl+p+l++ls++sss+
  evm.model.supercontig_77.48  84 AGSATASPCSSYH--------PSPCASYNPSPASSSFPSPASSSYAANPNGdgHSLIPWLKNLSSASSSA 145
                                  *************........******************98876665544455**********9988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.5E-663139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MTSGTRLPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEPDGTTY RKGCKPVERM DIVAGSATAS PCSSYHPSPC ASYNPSPASS SFPSPASSSY  120
AANPNGDGHS LIPWLKNLSS ASSSASSAKL PHLYIHGGSI SAPVTPPLSS PTARTPRIKT  180
DWEDQSARPG WSGQHHSFLH SSTPPSPGRQ IIPDPEWFAG IRLPQAGPTS PTFSLVSSKP  240
FGLPSGGSRM WTPGQSGTCS PAMPAGCDQT ADVPMGEVIP EEFAFGNNTT GLVKPWEGER  300
IHEECGSDDL ELTLGSSRTS ALRKLTKEKE YKGIKSSAFV VMITRDLFDD HFAHLVLSLA  360
TNMLWSNPIR LYISYPFVAV SSTINSDSCY QLFGLKLLTQ PNYYES*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007021866.11e-175BES1/BZR1
RefseqXP_010644097.11e-175PREDICTED: BES1/BZR1 homolog protein 4
SwissprotQ9ZV881e-145BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A061F8K91e-175A0A061F8K9_THECC; BES1/BZR1
STRINGVIT_19s0014g00870.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP15951542
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-126BES1/BZR1 homolog 4