PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_75.88
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRAS
Protein Properties Length: 547aa    MW: 59779.8 Da    PI: 5.295
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_75.88genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS421.19.2e-1291555211374
                         GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaa 80 
                                  lv+ L++cAe v+ g+l la +l++ ++ l    ++g  + ++a yf  AL++r+++  ++l+ +++ s+ +      +   
  evm.model.supercontig_75.88 155 LVHMLMTCAESVQRGELPLAGSLIEDMRGLlaHVNQGCGIGKVAGYFIDALNRRILSPPQSLAVSVNGSAFE------NEIL 230
                                  689*************************9987778899*******************666666555555554......4556 PP

                         GRAS  81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetg 162
                                  ++ f+e++P+lkf+h+taNqaIlea++g+++vH++Df++++GlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++ +++l+e+g
  evm.model.supercontig_75.88 231 YHHFYEACPYLKFAHFTANQAILEAFDGHDCVHVVDFNLMHGLQWPALIQALALRPGGPPLLRLTGIGPPSPDGRDSLREIG 312
                                  789******************************************************************************* PP

                         GRAS 163 erLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveq 244
                                   rLa++A++++v+f f+ ++a+rled+++++L+v+p+EalaVn+++qlhrll  +++ +s+++ vL  +++l+Pk+++vveq
  evm.model.supercontig_75.88 313 LRLAELARSVNVRFAFRGVAASRLEDVKPWMLQVSPKEALAVNSIMQLHRLLGADQNRNSPIEMVLGWIRNLNPKIMTVVEQ 394
                                  ********************************************************************************** PP

                         GRAS 245 eadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkp 326
                                  ea+hn+++F++rf+eal+yys++fdslea   + + e+++ E + ++rei+nv++ceg++r erhe lekWr+rl++aGFkp
  evm.model.supercontig_75.88 395 EASHNQPDFFDRFTEALYYYSTMFDSLEAC--AMQPEKAFAEIH-IQREICNVLCCEGSARLERHEPLEKWRSRLGRAGFKP 473
                                  ***************************999..466777777777.************************************* PP

                         GRAS 327 vplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                  + l+++a kqa++ll  ++ dgy vee++g+l+lgW++rpL+++SaW+
  evm.model.supercontig_75.88 474 LYLGSNAFKQASMLLTLFSADGYCVEENEGCLTLGWHSRPLIAASAWQ 521
                                  ***********************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011291.2E-2137109No hitNo description
PfamPF120412.3E-3037103IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098563.099129501IPR005202Transcription factor GRAS
PfamPF035143.2E-126155521IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MVLYDPATSA ATSSSGSTSA GSSFSYATKN PPPPDMDGLL AGAGYKVRSS DLRQVAQRLE  60
RLETAMVNSP SELSVLASDA VHYNPTDLAS WVDSLLSELA QPPPPPLPDF PPSDLFIGNA  120
VNHAAIDTDN SSWADQQGQQ LTVVTAMEED SGIRLVHMLM TCAESVQRGE LPLAGSLIED  180
MRGLLAHVNQ GCGIGKVAGY FIDALNRRIL SPPQSLAVSV NGSAFENEIL YHHFYEACPY  240
LKFAHFTANQ AILEAFDGHD CVHVVDFNLM HGLQWPALIQ ALALRPGGPP LLRLTGIGPP  300
SPDGRDSLRE IGLRLAELAR SVNVRFAFRG VAASRLEDVK PWMLQVSPKE ALAVNSIMQL  360
HRLLGADQNR NSPIEMVLGW IRNLNPKIMT VVEQEASHNQ PDFFDRFTEA LYYYSTMFDS  420
LEACAMQPEK AFAEIHIQRE ICNVLCCEGS ARLERHEPLE KWRSRLGRAG FKPLYLGSNA  480
FKQASMLLTL FSADGYCVEE NEGCLTLGWH SRPLIAASAW QATPNPSAPF AMISNHQTNG  540
NNNNLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-521555214375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008343960.10.0PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI-like
RefseqXP_008390123.10.0PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI-like
SwissprotQ9LQT81e-166GAI_ARATH; DELLA protein GAI
SwissprotQ5BN221e-165RGA2_BRACM; DELLA protein RGA2
TrEMBLQ0HA680.0Q0HA68_MALDO; DELLA protein
STRINGVIT_11s0016g04630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MalvidsOGEM160451015
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-145GRAS family protein