PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_7.239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HRT-like
Protein Properties Length: 135aa    MW: 14325.2 Da    PI: 9.3528
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_7.239genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like31.23.8e-105277126
                     HRT-like  1 iCGviledGsvCkrqPvkgRKRCeeH 26
                                 +CG++l++Gs+C+r+  kg  RC++H
  evm.model.supercontig_7.239 52 VCGAALRNGSFCTRSLTKGHERCWQH 77
                                 7************************* PP

2HRT-like54.12.5e-17100129130
                     HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                                  iCGv+   GsvC+++P+ gRKRCe+HKGmR
  evm.model.supercontig_7.239 100 ICGVTSPGGSVCEKSPAGGRKRCEQHKGMR 129
                                  8***************************** PP

Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MKINALISKS AKNKSGVNLG GCASDNELHN DPASKSMLFS DRCSTDRDPK TVCGAALRNG  60
SFCTRSLTKG HERCWQHRVN GCDSSFSCSL KSDSQSRSVI CGVTSPGGSV CEKSPAGGRK  120
RCEQHKGMRL IVSQ*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator involved in the regulation of cell differentiation in meristems (By similarity). Binds DNA without sequence preference (PubMed:22226340). {ECO:0000250|UniProtKB:F4K933, ECO:0000269|PubMed:22226340}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_7.239
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021907781.13e-90LOW QUALITY PROTEIN: protein EFFECTOR OF TRANSCRIPTION 2-like
SwissprotF4JU691e-16ET1_ARATH; Protein EFFECTOR OF TRANSCRIPTION 1
TrEMBLA0A2P2PIH48e-19A0A2P2PIH4_RHIMU; Uncharacterized protein LOC103453197
STRINGevm.model.supercontig_7.2392e-93(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29542763
Representative plantOGRP52481420
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26170.12e-17