PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_695.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 354aa    MW: 38768.6 Da    PI: 4.1088
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_695.4genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF435.7e-14345446
                                 -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
                       SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                                 en+   qv fsk r  ++KKA+EL++LC  +v +i+fs+ ++ 
  evm.model.supercontig_695.4  3 ENEASLQVIFSKHRSSLFKKASELCTLCRPDVGLIVFSPGNRA 45
                                 888999********************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-11151IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.526152IPR002100Transcription factor, MADS-box
PfamPF003194.9E-17248IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-16271IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-61429IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-62950IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MMENEASLQV IFSKHRSSLF KKASELCTLC RPDVGLIVFS PGNRAFCYGN PNIDIVIDCF  60
LSIDAQDKEE AARKRGKELK QRRKGLMKEL WYTRSMDKFN LEELEVLDVG MKALWNDVAE  120
LAKKLKKEQG NSSSAEGSPR DDGMFYSDPA MKTLTTLPNP THEYAPSSTN STPPLSSFCN  180
LDSGNPNIMM MDNPLNDSSM ALDPVDDLMA MPRDLFNNLV MIESDDPIAA LNAGDNPDIM  240
SDAFGNQIAT MDINLSNDPN IGPNEFFNPS TMPHAPNDPI STTSDALNMI RIVPDDSNLN  300
SVFDGFTLEM LFADPLDDEN FIVDNPNEVA NGDNPKTMPP PLAGNVLGSG QGI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_695.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2385900.0AC238590.1 Carica papaya BAC clone 12I03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021887443.10.0agamous-like MADS-box protein AGL62
STRINGevm.model.supercontig_695.40.0(Carica papaya)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.18e-22AGAMOUS-like 62